Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein R119 (MIMI_R119)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and pre-arranged. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its implementation.
Synonyms
MIMI_R119; Uncharacterized protein R119
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-165
Protein Length
full length protein
Species
Acanthamoeba polyphaga mimivirus (APMV)
Target Names
MIMI_R119
Target Protein Sequence
MSLDSENTISENNDVRINNINLIASIVLWLLFVITVIGTFKPIHRVSMESNFSKYYKYTY CVDDKCTCVDYFTYGKVTIYCYNKNSVNCLAINWDNVGIIVILIFMLMIIMNGFYQMMKQ KISVEDLVIMNQQLEYQRQNRMNNLYYHDNYGNLRMRMPGDYGYY
Uniprot No.

Target Background

Database Links

KEGG: vg:9924718

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure of MIMI_R119?

MIMI_R119 is a full-length protein consisting of 165 amino acids, with the following sequence: MSLDSENTISENNDVRINNINLIASIVLWLLFVITVIGTFKPIHRVSMESNFSKYYKYTYCVDDKCTCVDYFTYGKVTIYCYNKNSVNCLAINWDNVGIIVILIFMLMIIMNGFYQMMKQKISVEDLVIMNQQLEYQRQNRMNNLYYHDNYGNLRMRMPGDYGYY . Structural analysis suggests MIMI_R119 may be membrane-associated based on its amino acid properties and the presence of hydrophobic regions that could form transmembrane domains. Researchers can perform hydropathy plot analysis using tools like TMHMM or Phobius to predict transmembrane regions, followed by circular dichroism spectroscopy to experimentally determine secondary structure elements. For advanced structural characterization, techniques such as X-ray crystallography or cryo-electron microscopy should be considered, though no resolved 3D structure is currently available in public databases.

How is recombinant MIMI_R119 typically expressed and purified?

Recombinant MIMI_R119 is commonly expressed in E. coli expression systems with an N-terminal His-tag for purification purposes . For optimal expression, researchers should consider codon optimization of the gene sequence for E. coli, as viral codon usage may differ significantly. The typical expression procedure involves transformation of the gene construct into an appropriate E. coli strain (such as BL21(DE3)), followed by culture in LB or other suitable media, with induction using IPTG when cultures reach mid-log phase. Purification is achieved through immobilized metal affinity chromatography (IMAC) using Ni-NTA resins to capture the His-tagged protein. For membrane-associated proteins like MIMI_R119, addition of detergents (such as n-dodecyl-β-D-maltoside) during lysis and purification steps is critical to maintain solubility and prevent aggregation .

What are the appropriate storage conditions for MIMI_R119?

MIMI_R119 is typically supplied as a lyophilized powder and should be stored at -20°C/-80°C upon receipt . For working with the protein, reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL is recommended. To prevent protein degradation during storage, addition of glycerol to a final concentration of 5-50% is advised, with 50% being the most common concentration for long-term storage . After reconstitution, the protein should be aliquoted to avoid repeated freeze-thaw cycles, as these can lead to protein denaturation and loss of function. Working aliquots can be stored at 4°C for up to one week, while long-term storage requires -20°C or -80°C conditions . Researchers should monitor protein stability using methods such as SDS-PAGE or size exclusion chromatography when using stored samples to ensure experimental reliability.

What approaches can be used to elucidate the function of MIMI_R119 in mimivirus biology?

Elucidating the function of MIMI_R119 requires a multi-faceted approach that combines bioinformatic prediction, protein-protein interaction studies, and functional assays within the context of viral infection. Given that MIMI_R119 falls into the category of ORFans (genes without homologs in other organisms), standard homology-based function prediction may yield limited results. Researchers should employ several complementary strategies:

  • Temporal expression analysis: qRT-PCR and proteomics at different stages of viral infection to determine when MIMI_R119 is expressed, which could indicate early (pre-replication) or late (virion assembly) functions.

  • Immunolocalization studies: Using antibodies against MIMI_R119 to track its subcellular localization during infection cycles, particularly investigating potential association with viral membranes or the nucleoid structure.

  • Protein-protein interaction studies: Yeast two-hybrid screens, co-immunoprecipitation, or proximity labeling techniques (BioID, APEX) to identify binding partners within the viral proteome or host cell proteins.

  • Genetic approaches: CRISPR-Cas9 or homologous recombination techniques to generate mimivirus mutants with deleted or modified MIMI_R119, followed by phenotypic analysis of infection efficiency, virion morphology, and genome packaging.

  • Structural studies: As highlighted in the genomic fiber studies, mimivirus proteins often have unexpected structural roles in virion organization; investigating if MIMI_R119 contributes to the virion structure would be valuable .

These approaches together can provide strong evidence for functional roles, particularly considering the membrane association suggested by sequence analysis.

How might MIMI_R119 relate to the helical nucleoprotein structure of the mimivirus genome?

Recent research has revealed that the mimivirus genome is organized into an elegant 30-nm diameter helical nucleoprotein fiber composed primarily of GMC-type oxidoreductases . While MIMI_R119 has not been directly identified as part of this structure, several methodological approaches can investigate potential relationships:

  • Proteomics analysis: Researcher should isolate purified genomic fibers using the established protocol involving limited proteolysis and sucrose gradient purification , followed by mass spectrometry analysis to detect the presence of MIMI_R119.

  • Interaction studies: Using recombinant MIMI_R119, researchers can perform in vitro binding assays with purified genomic fibers or individual components like the GMC-type oxidoreductases to detect direct interactions.

  • Structural complementation: If MIMI_R119 is suspected to contribute to genome organization, researchers can perform complementation assays where mimivirus particles are partially disassembled and reconstituted with or without recombinant MIMI_R119, followed by electron microscopy to observe structural differences.

  • Comparative analysis: The nucleoprotein fiber's central channel has been found to accommodate RNA polymerase subunits and oxidative stress proteins . Analyzing MIMI_R119's dimensions and biochemical properties could indicate whether it might similarly reside in this channel, potentially serving a role in transcription initiation or genome protection.

The methodological approaches should focus on testing specific hypotheses about MIMI_R119's role within the context of mimivirus genome organization, considering that the virus employs parsimonious use of proteins in multiple structural contexts .

What is known about MIMI_R119's potential membrane association and its implications?

Sequence analysis of MIMI_R119 suggests membrane-association properties with potential transmembrane regions . This characteristic has significant implications for viral biology that researchers can investigate using several methodological approaches:

  • Membrane topology mapping: Researchers can employ protease protection assays combined with epitope tagging at various positions to determine which regions of MIMI_R119 are exposed to cytoplasmic or luminal environments.

  • Lipid interaction studies: Using techniques such as liposome flotation assays or lipid strip binding assays to determine if MIMI_R119 has specific lipid binding preferences, which could indicate roles in membrane remodeling during infection.

  • Host membrane targeting: Transfection studies expressing fluorescently-tagged MIMI_R119 in host cells can reveal which cellular membranes it associates with (ER, Golgi, nuclear envelope, etc.), providing clues to function.

  • Viral entry studies: Given that membrane-associated viral proteins often facilitate host cell entry, researchers should investigate if antibodies against MIMI_R119 can neutralize viral infectivity, suggesting a role in the entry process.

  • Structural studies of membrane integration: Techniques such as cryo-electron microscopy of membrane-reconstituted MIMI_R119 can provide insights into how it integrates into lipid bilayers.

The membrane association of MIMI_R119 may be particularly relevant considering mimivirus's complex structure involving multiple membrane layers, including one that lines the capsid shell and another encasing the nucleoid . Understanding how MIMI_R119 contributes to these membrane structures could reveal important aspects of mimivirus assembly and infection processes.

How should researchers optimize recombinant MIMI_R119 expression for functional studies?

Optimizing recombinant MIMI_R119 expression requires careful consideration of several factors due to its potential membrane association and viral origin. The methodological approach should include:

  • Expression system selection: While E. coli is commonly used , membrane proteins often benefit from eukaryotic expression systems like insect cells (baculovirus) or mammalian cells that provide appropriate membrane insertion machinery. Researchers should compare expression in multiple systems:

Expression SystemAdvantagesDisadvantagesSuitability for MIMI_R119
E. coliHigh yield, low cost, rapid growthLimited post-translational modifications, inclusion body formationGood for initial studies, requires optimization for membrane proteins
Baculovirus/Insect cellsProper folding of complex proteins, higher-order PTMsMore costly, slower productionExcellent for functional studies requiring native conformation
Mammalian cellsMost native-like processing, complex PTMsHighest cost, lowest yieldBest for interaction studies with host factors
  • Solubilization strategies: For membrane-associated proteins, inclusion of appropriate detergents during extraction is critical. Researchers should screen multiple detergents (e.g., n-dodecyl-β-D-maltoside, digitonin, CHAPS) at varying concentrations to optimize solubilization while maintaining native structure.

  • Tag position optimization: While N-terminal His-tags are common , they may interfere with membrane insertion. Researchers should create constructs with both N-terminal and C-terminal tags, as well as cleavable tags, to determine optimal configuration for functional studies.

  • Refolding protocols: If inclusion bodies form, systematic refolding screens using different buffer conditions, pH values, and additives should be employed, with functionality assessed after each condition to identify optimal refolding parameters.

  • Functional validation: Each preparation should be validated for proper folding using techniques such as circular dichroism, thermal shift assays, or limited proteolysis to ensure that the recombinant protein maintains native-like properties before use in functional studies.

What are the key considerations for generating antibodies against MIMI_R119?

Generating specific and high-affinity antibodies against MIMI_R119 requires strategic planning due to its unique sequence and potential membrane association. Researchers should consider the following methodological approaches:

  • Antigen preparation strategy:

Antigen TypeAdvantagesDisadvantagesRecommended Applications
Full-length recombinant proteinComplete epitope repertoireDifficult solubility for membrane proteinsWestern blot, immunoprecipitation
Synthetic peptidesEasy production, high purityLimited epitopes, may miss conformational epitopesRegion-specific detection, phospho-specific antibodies
DNA immunizationIn vivo folding, native conformationLower titer, more complex protocolNeutralization assays, conformational studies
  • Epitope selection for peptide antibodies: Researchers should analyze the MIMI_R119 sequence for regions with high predicted antigenicity, surface exposure, and minimal sequence similarity to host proteins. Multiple prediction algorithms (Bepipred, ABCpred) should be used to identify consensus epitope regions. For MIMI_R119, hydrophilic segments that are not part of predicted transmembrane domains make ideal candidates.

  • Validation methodology: Generated antibodies must be rigorously validated through:

    • ELISA against recombinant protein and peptides

    • Western blot against recombinant protein and mimivirus-infected cell lysates

    • Immunofluorescence microscopy of infected cells with appropriate controls

    • Specificity testing against related viral proteins

    • Preabsorption controls to confirm specificity

  • Application-specific considerations: Different applications require different antibody properties. For structural studies, conformation-specific antibodies recognizing native protein are essential, while for localization studies, high specificity in the complex environment of infected cells is critical.

  • Species selection: Considering that mimivirus infects amoebae, researchers should select antibody production host species with minimal cross-reactivity to amoeba proteins to reduce background in localization studies.

How should researchers approach phylogenetic analysis of MIMI_R119 given its ORFan status?

Phylogenetic analysis of ORFan genes like MIMI_R119 presents unique challenges due to the absence of clear homologs in other organisms. Researchers should employ a structured methodological approach:

  • Beyond standard homology searches: While basic BLAST searches may yield few results, researchers should employ position-specific iterative BLAST (PSI-BLAST), hidden Markov model-based searches (HMMER), and structure-based homology prediction (HHpred) with relaxed threshold parameters to detect distant relationships.

  • Structural homology detection: Even when sequence homology is minimal, structural conservation may exist. Tools like Phyre2 or I-TASSER can predict structural models of MIMI_R119 that can be compared against structural databases to identify proteins with similar folds despite low sequence identity.

  • Domain-based analysis: Researchers should segment MIMI_R119 into potential functional domains and analyze each separately, as individual domains may show homology patterns not evident in full-length comparisons.

  • Contextual genomic analysis: Examine the genomic neighborhood of MIMI_R119 in different mimivirus strains, as functionally related genes often cluster together. Co-evolution analysis of genes with correlated presence/absence patterns across viral strains can provide functional insights.

  • Taxonomically restricted comparative analysis: When standard phylogenetics fails, researchers should create custom datasets of all available mimivirus genomes to analyze micro-evolution of MIMI_R119 within the Mimiviridae family, identifying conserved regions that suggest functional importance.

  • Data interpretation framework: Researchers should interpret results in terms of:

    • Unique vs. conserved regions within Mimiviridae

    • Potential functional convergence with unrelated proteins

    • Evidence for horizontal gene transfer events

    • Signatures of selection pressure

This comprehensive approach can reveal evolutionary insights even for genes with no detectable homologs outside their immediate viral family.

What approaches should be used to analyze potential interactions between MIMI_R119 and host factors?

Understanding virus-host interactions is crucial for deciphering the function of viral proteins. For MIMI_R119, researchers should employ a multi-faceted methodological approach:

  • Systematic interaction screening: Researchers should conduct:

    • Yeast two-hybrid screening against normalized amoeba cDNA libraries

    • Affinity purification-mass spectrometry (AP-MS) using tagged MIMI_R119 as bait in amoeba cell lysates

    • Proximity labeling approaches (BioID, APEX) in infected cells to capture transient interactions

  • Bioinformatic prediction of interaction interfaces: Computational tools like HADDOCK or ClusPro can predict potential binding interfaces between MIMI_R119 and candidate host proteins based on structural models and physicochemical properties.

  • Validation hierarchy for candidate interactions:

Validation LevelTechniquesCriteria for Confirmation
Primary confirmationCo-immunoprecipitation, pull-down assaysReproducible interaction under native conditions
Functional relevancesiRNA/CRISPR knockout of host factorImpact on viral replication/fitness
Direct interactionSurface plasmon resonance, microscale thermophoresisBinding kinetics and affinity measurements
Structural validationCross-linking mass spectrometry, hydrogen-deuterium exchangeIdentification of specific interaction interfaces
  • Spatiotemporal dynamics analysis: Researchers should track when and where interactions occur during the viral infection cycle using time-course experiments and subcellular fractionation.

  • Comparative analysis across viral strains: Testing interactions with homologs of MIMI_R119 from related mimiviruses can reveal conserved and divergent interaction patterns, indicating core host factors versus strain-specific adaptations.

  • Functional consequences assessment: Beyond identifying interactions, researchers must determine their biological significance through techniques such as mutational analysis of binding interfaces, competitive inhibition assays, and assessment of changes in host cell physiology.

This systematic approach provides both discovery and validation frameworks for host-pathogen interactions involving MIMI_R119.

How can researchers determine if MIMI_R119 undergoes post-translational modifications?

Post-translational modifications (PTMs) can significantly impact protein function and localization. For MIMI_R119, a structured methodological approach to PTM identification includes:

  • Integrated mass spectrometry workflow:

    • Enrichment strategies for specific modifications (phosphopeptides, glycopeptides)

    • Multiple proteolytic digestion strategies to maximize sequence coverage

    • Combination of collision-induced dissociation (CID) and electron-transfer dissociation (ETD) for optimal PTM site localization

    • Parallel analysis of recombinant protein versus native protein from viral particles

  • Targeted analysis of predicted modification sites: Bioinformatic tools can predict potential sites for common modifications:

    • Phosphorylation sites (NetPhos, GPS)

    • Glycosylation sites (NetNGlyc, NetOGlyc)

    • Ubiquitination sites (UbPred)

    • Membrane-associated proteins often undergo lipidation (CSS-Palm for palmitoylation)

  • Site-directed mutagenesis validation: For identified or predicted PTM sites, researchers should generate point mutations (e.g., S/T→A for phosphorylation sites) and assess:

    • Impact on protein localization using fluorescent tagging

    • Changes in protein-protein interactions

    • Alterations in protein stability or turnover rates

    • Effects on viral replication when mutant genes are reintroduced into viral genome

  • Temporal analysis during infection: Researchers should sample at multiple time points during viral infection to determine when modifications occur, correlating with specific stages of the viral lifecycle.

  • Quantitative analysis: For each identified modification, quantitative assessment (SILAC, TMT labeling) comparing different conditions can reveal regulatory patterns.

The presence of transmembrane regions in MIMI_R119 suggests that lipidation or glycosylation may be particularly relevant modifications to investigate, as these often influence membrane association and protein trafficking.

What experimental approaches could determine MIMI_R119's potential role in mimivirus virion assembly?

Investigating MIMI_R119's role in virion assembly requires methodologies that can track protein dynamics during the viral assembly process. Researchers should consider:

  • Time-course immunolocalization: Using validated antibodies, researchers should examine MIMI_R119 localization at different stages of the mimivirus replication cycle, correlating with known assembly markers and viral factory formation.

  • Pulse-chase experiments: Metabolic labeling of newly synthesized proteins combined with immunoprecipitation can reveal the kinetics of MIMI_R119 incorporation into virion structures.

  • Correlative light and electron microscopy (CLEM): By combining fluorescence microscopy of tagged MIMI_R119 with electron microscopy, researchers can precisely locate the protein within assembling viral particles at nanoscale resolution.

  • in vitro assembly systems: Developing reconstitution assays where purified viral components including MIMI_R119 are combined to observe assembly intermediates under controlled conditions.

  • Genetic approaches: Creation of temperature-sensitive mutants or inducible expression systems for MIMI_R119 can allow researchers to observe assembly defects when the protein is compromised at specific stages.

Given mimivirus's elegant genome packaging into helical fibers and multiple membrane layers, particular attention should be paid to MIMI_R119's potential role in genome packaging or membrane organization during virion formation.

How might researchers investigate potential enzymatic activities of MIMI_R119?

Despite being classified as an uncharacterized protein, MIMI_R119 may possess enzymatic functions that contribute to viral replication or host interaction. A methodical investigation would include:

  • In silico enzymatic function prediction: Researchers should employ tools like COFACTOR, EnzymeMiner, and EFICAz that can predict enzymatic function based on structural features even when sequence homology is limited.

  • Activity screening panel: Developing a systematic screening approach testing MIMI_R119 for common enzymatic activities relevant to viral processes:

Activity CategorySpecific AssaysRelevance to Viral Biology
Nucleic acid modificationDNase, RNase, helicase, polymerase activitiesGenome replication, transcription
Proteolytic activityFluorogenic peptide substrates, zymographyViral maturation, host defense evasion
Lipid modificationPhospholipase, lipid transferase activitiesMembrane remodeling during infection
Redox enzymesOxidoreductase, peroxidase activitiesResponse to host oxidative defenses
Host signaling modulationKinase, phosphatase, deubiquitinase activitiesManipulation of host pathways
  • Substrate identification approaches: If initial screens suggest enzymatic activity, researchers should employ:

    • Metabolomic profiling comparing wild-type and MIMI_R119-deficient infections

    • Activity-based protein profiling using reactive probes that capture active enzyme states

    • Mass spectrometry-based approaches to identify modified substrates

  • Structural studies of catalytic sites: If enzymatic activity is detected, structural analysis focused on active site residues can confirm mechanism:

    • Site-directed mutagenesis of predicted catalytic residues

    • Co-crystallization with substrates or substrate analogs

    • Molecular dynamics simulations of enzyme-substrate interactions

These approaches can reveal hidden enzymatic functions that might be overlooked in standard sequence-based analyses, particularly important for mimivirus proteins that often display novel functionality.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.