Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein R287 (MIMI_R287)

Shipped with Ice Packs
In Stock

Description

Overview of MIMI_R287

Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized Protein R287 (MIMI_R287) is a viral protein encoded by the MIMI_R287 gene of the giant mimivirus APMV. This protein remains functionally uncharacterized but has been commercially produced for research applications, particularly in ELISA and structural studies . It is expressed in E. coli or yeast systems and purified under controlled conditions to retain stability .

Functional Insights from Mimivirus Biology

While MIMI_R287’s exact role is unknown, studies on related mimivirus proteins provide context:

  • Virion-Associated Proteins: Mimivirus virions contain >137 proteins, many uncharacterized, involved in transcription, oxidative pathways, and membrane interactions .

  • DNA-Protein Interactions: Transfection experiments show that mimivirus DNA requires associated proteins (e.g., L442, R387) for infectivity, suggesting MIMI_R287 may play a role in genome packaging or host entry .

  • Post-Translational Modifications: Mimivirus proteins often undergo glycosylation or phosphorylation, which could regulate MIMI_R287’s activity .

4.2. Experimental Use Cases

  • Microinjection Studies: Mimivirus DNA transfection into A. castellanii requires protein co-factors, highlighting the potential utility of MIMI_R287 in viral replication assays .

  • Comparative Proteomics: Used alongside other uncharacterized proteins (e.g., R809) to map mimivirus-specific functional networks .

Unresolved Questions and Future Directions

  • Functional Role: MIMI_R287’s interaction partners and enzymatic activity (if any) remain unidentified.

  • Structural Analysis: X-ray crystallography or cryo-EM could clarify its 3D conformation .

  • Virophage Interactions: Studying MIMI_R287 in mimivirus-virophage systems may reveal defensive or regulatory roles .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please specify it in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary based on the purchasing method or location. Please consult your local distributor for specific delivery times.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquotting the solution. Store at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the intrinsic stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is decided during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
MIMI_R287; Uncharacterized protein R287
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-242
Protein Length
full length protein
Species
Acanthamoeba polyphaga mimivirus (APMV)
Target Names
MIMI_R287
Target Protein Sequence
MCWNYQVSLIFSVIYVVTNSYYVVKRPLYWKQYLLFGSFYLTMEVFQTLQWLFGNVYSDS MYGQSVCNSINVNYTIVAFILIWLQPILFSVIGYQTTTTNKWFFRVLTVLNCFVFFYGLK LLYGGFEKPDYYTISDSMFGSSTCTNEGETGHLVWRFKPKTLDVFPNHLTYIILCIISFV MYENNATRVIGLGWLLSLIVTKLLLAPTLVEIASSWCLLSIIANLLIVAYVHISTGIYLT GQ
Uniprot No.

Target Background

Database Links

KEGG: vg:9924902

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Acanthamoeba polyphaga mimivirus Uncharacterized protein R287?

MIMI_R287 is an uncharacterized protein from the Acanthamoeba polyphaga mimivirus (APMV), a member of the Mimiviridae family. It is a full-length protein comprising 242 amino acids and is available as a recombinant protein with His-tag expression in E. coli systems for research purposes. While its specific function remains largely uncharacterized, it represents an important component for understanding APMV biology and potentially its pathogenic mechanisms in various contexts .

How does MIMI_R287 relate to the broader Mimiviridae family?

MIMI_R287 is a protein from Acanthamoeba polyphaga mimivirus, which is one of the dominant species within the Mimiviridae family. Recent metagenomic studies have shown that in clinical samples where Mimiviridae are detected, Acanthamoeba polyphaga mimivirus can account for approximately 51-53% of the total Mimiviridae reads, followed by Moumouvirus at 46-47% and Cafeteria roenbergensis virus at about 1% . This relative abundance suggests MIMI_R287 belongs to a significant member of the viral family with potential clinical relevance, particularly in respiratory infections where these viruses have been detected.

What structural characteristics define MIMI_R287?

MIMI_R287 is primarily available for research as a recombinant full-length protein (1-242 amino acids) with a His-tag . While detailed structural information is limited in the current literature, researchers investigating this protein typically work with the full-length sequence to preserve potential functional domains. The His-tag fusion allows for efficient purification using affinity chromatography methods while maintaining protein integrity for downstream functional and structural studies.

How should experiments with MIMI_R287 be optimally designed?

When designing experiments with MIMI_R287, researchers should implement proper experimental design principles to ensure reliable and valid results. A completely randomized design (CRD) represents an appropriate starting point for initial characterization studies . This approach should include:

  • Clear hypothesis formulation specifically addressing MIMI_R287's properties or functions

  • Randomization of experimental units to treatment groups

  • Inclusion of appropriate positive and negative controls

  • Blinding procedures where applicable to minimize bias

  • Pre-determination of sample sizes through power analysis

  • Standardization of protein handling and storage conditions

Multiple independent replicates (minimum n=3) should be conducted for all critical experiments to ensure reproducibility and allow for appropriate statistical analysis .

What are the recommended approaches for studying protein interactions of MIMI_R287?

For investigating MIMI_R287 interaction networks, researchers should consider a multi-method approach:

  • Pull-down assays: Utilizing the His-tagged MIMI_R287 to capture potential binding partners from cell lysates, followed by mass spectrometry identification.

  • Yeast two-hybrid screening: For detecting binary protein-protein interactions.

  • Co-immunoprecipitation: To verify interactions in more physiologically relevant conditions.

  • Surface plasmon resonance: For quantitative binding kinetics measurements.

These techniques should be applied complementarily, as each has inherent limitations. The interaction data can then be organized in tabular format, similar to the framework provided for interaction studies :

Interaction MethodInteracting ProteinBinding Affinity (Kd)Validation Method
Pull-down/MS[Protein X]Not quantifiedWestern blot
Yeast two-hybrid[Protein Y]Not applicableCo-IP confirmation
SPR[Protein Z][Value] nMFunctional assay

How can statistical power be optimized in MIMI_R287 studies?

Determining appropriate sample sizes for experiments with MIMI_R287 requires careful power analysis. Researchers should consider:

  • Effect size estimation based on preliminary data or related studies

  • Appropriate significance level (typically α=0.05)

  • Desired power (typically 0.8 or higher)

  • Variability in measurements

This approach will help ensure that experiments are adequately powered to detect biologically relevant effects while balancing resource constraints . For complex experimental designs with multiple factors, consulting with a statistician during the planning phase is highly recommended to determine optimal sample allocation across experimental groups.

How can metagenomic analysis be applied to study MIMI_R287 in clinical samples?

Metagenomic analysis represents a powerful approach for investigating MIMI_R287 in clinical contexts. Based on recent studies of Mimiviridae detection, researchers should:

  • Extract total nucleic acids from clinical samples (e.g., respiratory specimens)

  • Perform next-generation sequencing using appropriate library preparation methods

  • Apply bioinformatic analysis with specific filtering criteria (e.g., nucleotide read per million ≥ 5)

  • Generate taxonomic trees for viral classification

  • Map reads specifically to the MIMI_R287 gene region

Recent studies have demonstrated the efficacy of this approach, showing that Mimiviridae can contribute significantly to the virome in clinical samples (24-44% of total virome reads) . Coverage metrics should be carefully assessed, as consistently low genome coverage may indicate technical limitations or biological factors affecting detection.

What advanced techniques are recommended for functional characterization of MIMI_R287?

For functional characterization of this uncharacterized protein, researchers should employ a systematic approach:

  • Computational analysis: Sequence-based predictions of domains, motifs, and potential functions using bioinformatics tools.

  • Recombinant expression: Expression in various systems beyond E. coli (e.g., insect cells) for proper folding and post-translational modifications.

  • Structural studies: X-ray crystallography, cryo-EM, or NMR for 3D structure determination.

  • Functional assays: Based on predicted functions or pathway associations, develop specific biochemical assays.

  • Gene editing: CRISPR-based modification of the R287 gene in viral genomes to study phenotypic effects.

These approaches should be conducted in parallel when possible to provide complementary lines of evidence for functional characterization.

How should researchers approach the detection of Mimivirus proteins in diverse sample types?

Detection of MIMI_R287 in diverse sample types requires optimized protocols for different matrices. Based on successful approaches for Mimiviridae detection , researchers should:

  • Develop sample-specific extraction protocols that maximize viral protein/nucleic acid recovery

  • Consider potential PCR inhibitors present in complex samples (soil, clinical specimens)

  • Employ both targeted (PCR, ELISA) and untargeted (metagenomic, proteomic) approaches

  • Include appropriate internal controls for extraction efficiency and detection sensitivity

  • Validate findings using orthogonal methods (e.g., confirming genomic detection with proteomic analysis)

For respiratory samples specifically, researchers should note that Mimiviridae reads have been detected in patients with severe acute respiratory infection and influenza-like illness, suggesting relevant clinical contexts for investigation .

How can contradictory results in MIMI_R287 research be resolved?

When faced with contradictory results in MIMI_R287 research, applying formal conflict analysis methods can help identify sources of discrepancy. This process should:

  • Define the conflict measure: conf(e) = log(P(e₁)×...×P(eₙ)/P(e₁,...,eₙ))

  • Identify when observations are negatively correlated (conf(e) is positive)

  • Distinguish between genuine rare cases and potentially flawed findings

  • Systematically trace conflicting evidence to its source

  • Consider uninstantiated variables that might explain the current conflict

This approach can be particularly valuable in diagnostic situations where a single flawed test result might lead investigations in an incorrect direction . When applied to MIMI_R287 research, this framework helps researchers critically evaluate contradictory findings across different studies or experimental approaches.

What statistical considerations are crucial for interpreting MIMI_R287 experimental results?

Proper statistical analysis is essential for valid interpretation of MIMI_R287 experiments. Key considerations include:

  • Selection of appropriate statistical tests based on data distribution and experimental design

  • Proper handling of multiple comparisons to control family-wise error rates

  • Consideration of hierarchical data structures when present

  • Testing for model assumptions (normality, homogeneity of variance)

  • Appropriate reporting of effect sizes alongside p-values

For designs with multiple factors, researchers should carefully build statistical models, considering main effects and interactions, and employ systematic hypothesis testing approaches . Empty cells in experimental designs (missing combinations of factors) require special analytical considerations to maintain valid inference.

How can researchers distinguish between true MIMI_R287 detection and potential artifacts?

Distinguishing genuine MIMI_R287 detection from artifacts requires rigorous validation approaches:

  • Implement appropriate negative controls at all experimental stages

  • Set stringent thresholds for positive detection (e.g., read count filters in genomic data)

  • Confirm findings using orthogonal detection methods

  • Assess biological plausibility of detected patterns

  • Evaluate coverage metrics across the target sequence

In metagenomic studies of Mimiviridae, consistently low genome coverage has been observed, highlighting the importance of careful interpretation . Researchers should be particularly cautious when working with complex clinical samples where contamination or cross-reactivity may occur, and should implement robust quality control measures throughout the experimental workflow.

What are the potential pathogenic implications of MIMI_R287 in clinical contexts?

Recent metagenomic studies have detected Mimiviridae reads in respiratory samples from patients with severe acute respiratory infection (SARI) and influenza-like illness (ILI) . While the specific role of MIMI_R287 in pathogenesis remains uncharacterized, these findings suggest several important research directions:

  • Investigation of potential interactions between MIMI_R287 and host immune factors

  • Assessment of MIMI_R287 expression during different stages of viral infection

  • Determination of whether MIMI_R287 contributes to viral replication or host immune evasion

  • Evaluation of MIMI_R287 as a potential diagnostic marker for Mimivirus infection

Particularly notable is the detection of Mimiviridae in elderly male patients with respiratory symptoms, contributing significantly to the virome composition (24-44% of total virome reads) . This suggests MIMI_R287 may be part of a clinically relevant viral family deserving further investigation in the context of respiratory infections.

How can MIMI_R287 research contribute to understanding viral evolution?

As an uncharacterized protein from a complex DNA virus, MIMI_R287 offers valuable opportunities for studying viral evolution:

  • Comparative genomic analyses with related viral families to trace evolutionary origins

  • Investigation of horizontal gene transfer events involving MIMI_R287

  • Study of selective pressures on MIMI_R287 across different viral hosts

  • Assessment of structural and functional conservation among related viral proteins

These approaches can provide insights into the evolutionary history of giant viruses and their protein repertoires, potentially revealing novel aspects of virus-host interactions and adaptation mechanisms.

What emerging technologies might advance MIMI_R287 research?

Several cutting-edge technologies hold promise for advancing MIMI_R287 research:

  • Long-read sequencing: For improved assembly and detection of Mimivirus genomes in complex samples

  • Cryo-electron microscopy: For high-resolution structural determination of MIMI_R287

  • Single-cell proteomics: To investigate MIMI_R287 expression at the individual cell level during infection

  • Machine learning approaches: For improved prediction of protein function based on limited structural data

  • Nanopore direct RNA sequencing: For studying MIMI_R287 transcription dynamics without amplification bias

Integration of these technologies with established methods will likely accelerate functional characterization and provide deeper insights into the biological roles of this uncharacterized protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.