Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein R305 (MIMI_R305)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, specific format requirements should be noted during order placement to ensure fulfillment.
Lead Time
Delivery times vary depending on purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MIMI_R305; Uncharacterized protein R305
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-169
Protein Length
full length protein
Species
Acanthamoeba polyphaga mimivirus (APMV)
Target Names
MIMI_R305
Target Protein Sequence
MNENFICNKYFVTILIIIIIILIVLLIVFLTKKNSRIERMENIDKLTFAEKPWSNTQDAD TYKIVDNDFDKYVDELTKLLGNKNRAKRKDEVYRDYIQSKPINKNNQQTKNTPTPLDDRP DLSQCQPCICPNDRYIPNSESSENDNHLDREIRKKISELGSYVKNKYKR
Uniprot No.

Target Background

Database Links

KEGG: vg:9924921

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What are the best methodologies for initial characterization of uncharacterized mimivirus proteins like R305?

Initial characterization of uncharacterized mimivirus proteins like R305 requires a multi-faceted approach:

  • Sequence analysis and domain prediction: Utilize tools like InterProScan to identify potential functional domains, as demonstrated in the successful identification of the MC1 domain in Mimivirus gp275 . For R305, preliminary sequence analysis should include:

    • Multiple sequence alignment with homologs

    • Secondary structure prediction

    • Conserved motif identification

    • Phylogenetic analysis to identify evolutionary relationships

  • Expression and purification: Express the recombinant protein using a bacterial expression system with appropriate tags for purification, similar to the approach used for other mimivirus proteins . For optimal expression:

    • Test multiple expression conditions (temperature, induction time, media)

    • Use fusion tags that enhance solubility (MBP, SUMO, GST)

    • Implement a purification strategy involving affinity chromatography followed by size exclusion

  • Preliminary functional assays: Based on sequence predictions, design targeted assays to test putative functions:

    • DNA/RNA binding assays if nucleic acid interaction is predicted

    • Enzymatic activity tests based on domain predictions

    • Interaction studies with host proteins

Remember that mimivirus proteins often have novel functions with limited homology to characterized proteins, necessitating a broad approach to functional characterization.

How do I express and purify recombinant mimivirus proteins for laboratory studies?

Expression and purification of mimivirus proteins requires careful optimization:

Expression Strategy:

  • Codon optimization: Adapt the viral gene sequence for expression in E. coli or other systems

  • Expression vector selection: Choose vectors with inducible promoters (T7, tac) and appropriate fusion tags

  • Expression conditions screening: Test using a factorial design approach as described in mimivirus nucleoside diphosphate kinase studies :

VariableConditions Tested
Temperature298K, 310K, 315K
MediaLB, 2YT, TB
Induction time3h, 6h, overnight
IPTG concentration0.1mM, 0.5mM, 1mM

Purification Protocol:

  • Cell lysis using sonication or pressure-based methods

  • Affinity purification (His-tag, GST-tag)

  • Ion exchange chromatography

  • Size exclusion chromatography for final polishing

Specific Considerations for Mimivirus Proteins:

  • Co-expression with chaperones like GroEL-GroES system can significantly improve folding and solubility

  • For difficult-to-express proteins, consider using eukaryotic expression systems like insect cells

  • Validate protein integrity using mass spectrometry to confirm identity

What techniques can determine if R305 interacts with viral DNA or host cell components?

To investigate potential interactions of R305 with viral DNA or host components, employ these methodologies:

DNA/RNA Interaction Analysis:

  • Electrophoretic Mobility Shift Assay (EMSA): Test binding to different DNA/RNA substrates, as performed for the gp275 protein which demonstrated DNA compaction properties

  • Chromatin Immunoprecipitation (ChIP): Identify genomic regions bound by R305 during infection

  • Fluorescence anisotropy: Measure binding affinities to nucleic acids

  • Microscale thermophoresis (MST): Quantify binding under various conditions

Protein-Protein Interaction Studies:

  • Co-immunoprecipitation: Identify host or viral protein binding partners

  • Yeast two-hybrid screening: Discover novel interactions

  • Proximity labeling approaches: BioID or APEX2 tagging to identify proteins in proximity during infection

  • Mass spectrometry-based interactomics: Similar to approaches used for mimivirus proteomics

In situ Visualization:

  • Fluorescence microscopy with tagged proteins: Similar to the approach used for tracking gp275-EGFP, which revealed co-localization with viral factories

  • Immuno-electron microscopy: Precisely localize the protein within the viral particle or infected cell

Integration of datasets from different techniques provides the most reliable evidence for functional interactions.

How can gene silencing approaches be applied to determine the function of R305 in the mimivirus replication cycle?

Gene silencing for mimivirus proteins requires specialized approaches due to the unique characteristics of these viruses:

RNA Interference Strategy:

  • siRNA design and delivery: Design siRNAs targeting R305 using algorithms that account for accessibility and specificity. The success of this approach has been demonstrated for the R458 translation initiation factor :

    • Design 3-4 siRNA duplexes targeting different regions of the R305 gene

    • Use Lipofectamine transfection into amoeba cells prior to infection

    • Confirm knockdown efficiency via RT-PCR, similar to techniques used for R458

Gene Knockout Methodology:

  • Homologous recombination: As successfully employed for tagging and knockout studies of other mimivirus genes :

    • Design homologous recombination cassettes with ~500bp homology arms

    • Include selectable markers or fluorescent reporters

    • Screen recombinants using PCR and sequencing

Phenotypic Analysis:

  • Growth curve analysis: Monitor viral replication kinetics compared to wild-type

  • Electron microscopy: Assess morphological changes in virus assembly

  • Fluorescence microscopy: Track viral factory formation and morphology

  • Proteomic analysis: Perform comparative 2D-DIGE to identify deregulated proteins, as done for R458 silencing which revealed changes in 32 different viral proteins

Data Analysis Framework:

  • Multi-parameter phenotyping: Combine growth data with structural observations and molecular analyses

  • Temporal expression profiling: Determine when R305 functions during the infection cycle

  • Rescue experiments: Complement with recombinant protein to confirm phenotype specificity

This comprehensive approach can reveal whether R305 is essential (like gp275 ) or modulates specific aspects of the mimivirus replication cycle.

What structural biology techniques would be most effective for characterizing R305, and how should experiments be designed?

Structural characterization of R305 requires a strategic experimental pipeline:

Initial Screening and Sample Preparation:

  • Construct optimization: Generate multiple constructs with different boundaries based on:

    • Secondary structure predictions

    • Disorder predictions (IDRs may interfere with crystallization)

    • Domain boundaries

  • Solubility and stability screening: Evaluate using differential scanning fluorimetry with various buffers

  • Oligomeric state determination: Employ size exclusion chromatography coupled with multi-angle light scattering (SEC-MALS)

Crystallography Approach:

  • Crystallization condition screening: Use sparse matrix screens followed by optimization

  • Data collection strategy: Based on the successful approach for mimivirus NDK :

ParameterDetails
X-ray sourceSynchrotron radiation (e.g., ESRF beamline)
Temperature100K
Data processingXDS, CCP4 suite
Molecular replacementTest multiple homology models as search models
  • Phase determination alternatives: If molecular replacement fails due to limited homology, consider:

    • Heavy atom derivatives

    • Selenomethionine labeling

    • De novo phasing methods

Alternative Approaches:

Integration with Functional Studies:

  • Perform mutagenesis of key residues identified from structures

  • Co-crystallize with potential binding partners (DNA, RNA, or proteins)

  • Use structures to guide design of inhibitors or functional probes

The combination of multiple structural techniques provides complementary information that can overcome limitations of individual methods.

How can comparative proteomics approaches be utilized to understand R305's role in mimivirus infection?

Comparative proteomics provides powerful insights into protein function during infection:

Experimental Design for Proteomic Analysis:

  • Viral proteome comparison: Compare wild-type mimivirus with R305-knockout or silenced virus using:

    • Two-dimensional difference gel electrophoresis (2D-DIGE) as applied to R458 studies

    • Label-free quantitative proteomics

    • Tandem mass tag (TMT) labeling for multiplexed comparisons

  • Temporal proteomics: Sample at multiple time points post-infection to track dynamic changes:

    • Early phase (0-4h): Host response

    • Middle phase (4-8h): Viral factory formation

    • Late phase (8-24h): Virion assembly

  • Subcellular fractionation: Separate viral factories, host cytoplasm, and virions to localize effects

Data Analysis Pipeline:

  • Protein identification and quantification:

    • Database searching against both mimivirus and host proteomes

    • Normalization to account for loading differences

    • Statistical analysis to identify significantly altered proteins

  • Functional clustering: Group deregulated proteins by:

    • Temporal expression pattern

    • Functional category

    • Protein-protein interaction networks

  • Validation of key findings: Confirm important protein changes using:

    • Western blotting

    • Targeted proteomics (SRM/MRM)

    • Immunofluorescence microscopy

Integration with Other -Omics Approaches:

  • Correlate proteomic changes with transcriptomic data

  • Map affected proteins onto metabolic pathways

  • Identify regulatory networks through systems biology approaches

The 2D-DIGE approach used for R458 silencing revealed deregulation of 83 peptide spots corresponding to 32 different proteins , demonstrating the power of this approach for understanding mimivirus protein functions.

How do I resolve contradictory data when characterizing mimivirus proteins like R305?

Resolving contradictory data requires systematic troubleshooting and integration approaches:

Common Sources of Contradictions in Mimivirus Research:

  • Technical variability: Different expression systems, tags, or assay conditions

  • Biological complexity: Multiple functions of a single protein

  • Context-dependency: Protein behavior in isolation versus in infection context

  • Strain differences: Variations between mimivirus isolates and lineages

Systematic Resolution Approach:

  • Experimental validation matrix:

Contradiction TypeResolution StrategyExample Application
Functional activity discrepanciesTest multiple substrates/conditionsCompare DNA binding across different sequences and buffer conditions
Localization conflictsUse multiple tagging strategiesCompare C-terminal vs N-terminal tags, different fluorophores
Interaction partner disagreementsApply orthogonal methodsCombine co-IP, Y2H, and proximity labeling approaches
Essentiality disputesTest in multiple mimivirus lineagesCompare knockout effects in lineages A, B, and C
  • Contextual analysis: Evaluate if contradictions reflect different experimental contexts

    • In vitro vs. in vivo differences

    • Temporal changes during infection cycle

    • Concentration-dependent effects

  • Methodological cross-validation: Apply multiple techniques to the same question

    • For structural contradictions: Compare X-ray, NMR, and cryo-EM data

    • For functional contradictions: Combine biochemical, genetic, and cellular assays

Handling Contradictory Literature Data:

  • Assess methodological differences between studies

  • Evaluate reagent quality and experimental controls

  • Consider evolutionary differences between mimivirus strains

  • Design experiments that directly test contradictory claims

When contradictions persist, present multiple working models that can accommodate different observations until additional data can resolve the discrepancies.

What computational approaches can predict R305 function from sequence and structural data?

Computational prediction of R305 function requires integration of multiple bioinformatic approaches:

Sequence-Based Prediction Pipeline:

  • Homology detection: Apply sensitive sequence comparison tools:

    • PSI-BLAST for iterative profile searching

    • HHpred for hidden Markov model comparisons

    • HMMER searches against specialized databases

  • Motif and domain analysis:

    • InterProScan for integrated domain prediction (successful for identifying MC1 domain in gp275 )

    • MEME for de novo motif discovery

    • Structural motif recognition using PROSITE patterns

  • Evolutionary analysis:

    • Conservation mapping to identify functionally important residues

    • Coevolutionary analysis to identify residue networks

    • Phylogenetic profiling to identify functional associations

Structural Prediction Approaches:

  • Ab initio structure prediction:

    • AlphaFold2 for high-confidence structural models

    • Robetta for domain parsing and folding

    • I-TASSER for integrated structure-function prediction

  • Functional site prediction:

    • 3DLigandSite for binding pocket identification

    • ElectroSurfPot for electrostatic surface analysis

    • CASTp for cavity analysis

Integration with Experimental Data:

  • Structure-guided hypothesis generation:

    • Design targeted mutations based on predicted functional sites

    • Develop specific binding assays based on pocket predictions

    • Create truncation constructs guided by domain predictions

  • Iterative refinement:

    • Update predictions as experimental data becomes available

    • Use Bayesian approaches to integrate multiple prediction methods

    • Apply machine learning to improve prediction accuracy

The success of computational approaches has been demonstrated for other mimivirus proteins, such as the identification of the MC1-like domain in gp275, which led to experimental validation of its DNA architectural function .

How can I design experiments to test if R305 is essential for mimivirus replication?

Determining essentiality requires strategic experimental design:

Gene Knockout/Disruption Approaches:

  • Homologous recombination strategy:

    • Design targeting constructs with ~500bp homology arms flanking R305

    • Include selectable markers or fluorescent reporters

    • Screen recombinants using PCR and sequencing

    • Evaluate viability of resulting viruses

  • CRISPR-Cas system adaptation:

    • Design guide RNAs targeting R305

    • Introduce into amoeba cells prior to infection

    • Analyze resulting viral populations for mutations or deletions

Conditional Knockdown Systems:

  • Inducible expression systems:

    • Replace native R305 with an inducible version

    • Modulate expression levels during infection

    • Identify threshold levels required for replication

  • Degron-based approaches:

    • Tag R305 with degron sequences

    • Induce degradation at specific timepoints

    • Monitor effects on viral replication cycle

Phenotypic Analysis Framework:

  • Quantitative measures of viral replication:

    • Viral titer determination by plaque assays

    • qPCR for viral genome replication

    • Fluorescence microscopy for viral factory formation

  • Time-course analysis:

    • Monitor each stage of the viral life cycle

    • Identify specific steps affected by R305 disruption

    • Compare to known essential genes as positive controls

Control Experiments:

  • Complementation testing:

    • Provide R305 in trans to rescue knockout phenotypes

    • Use domain mutants to identify essential regions

    • Test cross-complementation with homologs from related viruses

  • Cross-validation with independent methods:

    • Combine genetic approaches with protein inhibition

    • Use multiple viral strains to confirm findings

    • Validate in different host amoeba species

The importance of this approach is highlighted by studies on gp275, where gene knockout analysis demonstrated it to be critical for viral multiplication , establishing it as an essential gene in the mimivirus replication cycle.

What methodological approaches can determine R305's role in host-pathogen interactions during infection?

Understanding R305's role in host-pathogen interactions requires multi-level analysis:

Temporal and Spatial Localization:

  • Fluorescent protein tagging:

    • Generate recombinant mimivirus expressing R305-fluorescent protein fusions

    • Track localization throughout infection cycle

    • Co-localize with cellular markers to identify compartmentalization

    • Similar to approaches used for tracking gp275-EGFP and gp455-RFP

  • High-resolution microscopy:

    • Confocal microscopy for dynamic tracking

    • Super-resolution techniques for precise localization

    • Correlative light-electron microscopy to link function with ultrastructure

Host Response Analysis:

  • Transcriptomic profiling:

    • Compare host cell responses to wild-type versus R305-deficient virus

    • Identify differentially expressed genes

    • Map onto signaling pathways

  • Host protein interaction screening:

    • Affinity purification-mass spectrometry to identify binding partners

    • Yeast two-hybrid screening against host proteome libraries

    • Protein arrays to test directed interactions

Signaling Pathway Impact:

  • Phosphoproteomics:

    • Identify changes in host protein phosphorylation during infection

    • Compare wild-type versus R305-deficient virus

    • Map altered phosphorylation sites to specific pathways

  • Targeted pathway analysis:

    • Monitor NF-κB pathway activation (shown to be affected by mimiviruses )

    • Assess TLR4 expression changes

    • Measure cytokine production

Experimental Design Considerations:

  • Time-resolved sampling:

    • Early (attachment/entry)

    • Mid (viral factory formation)

    • Late (virion assembly) phases

  • Controls and validations:

    • UV-inactivated virus controls

    • Multiple independent R305 mutants

    • Complementation experiments

  • Cell-type considerations:

    • Primary amoeba vs. established cell lines

    • Testing in alternate hosts (e.g., A549 cells as used in mimivirus studies )

This multi-faceted approach can reveal whether R305 functions primarily in viral replication, immune evasion, or modulation of host cellular processes during infection.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.