Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein R335 (MIMI_R335)

Shipped with Ice Packs
In Stock

Description

Introduction

The Acanthamoeba polyphaga mimivirus (APMV) is a giant virus known for its large genome and the presence of numerous uncharacterized proteins within its virion . Among these is the Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein R335 (MIMI_R335), a protein whose function remains largely unknown . Understanding the structure and function of such proteins is crucial to elucidating the complex mechanisms of viral infection and replication .

Secondary Structure

The secondary structure of a protein describes the spatial arrangement of amino acids that are close to each other in the sequence . Common secondary structures include $$ \alpha $$-helices and $$ \beta $$-pleated sheets, which are stabilized by hydrogen bonds .

  • $$ \alpha $$-helix: Formed when the CO group of each amino acid is hydrogen-bonded to the NH group of the amino acid four residues ahead in the linear sequence .

  • $$ \beta $$-pleated sheet: Formed by the alignment of polypeptide chains with hydrogen bonds between the C=O and N-H groups of adjacent chains .

Research Findings

Research has identified several uncharacterized proteins, including R335, as components of the Mimivirus virion that are possibly involved in the early stages of infection . A study involving the transfection of APMV DNA into Acanthamoeba castellanii highlighted the involvement of R335, along with other uncharacterized proteins such as L442, L724, L829, and R135, in the generation of infectious APMV virions .

ProteinPossible Function
L442Unknown
L724Unknown
L829Unknown
R335Unknown
R135Putative GMC-type oxidoreductase

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is requested. Please contact us in advance for dry ice shipping; additional fees will apply.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If a specific tag type is required, please inform us; we will prioritize its development.
Synonyms
MIMI_R335; Uncharacterized protein R335
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-306
Protein Length
full length protein
Species
Acanthamoeba polyphaga mimivirus (APMV)
Target Names
MIMI_R335
Target Protein Sequence
MNNNYHTQINRPNMLNEIAANNNLLNNKNNQTNQLNNNQYNNQYNNQNNNQNYPQNYPQN SQQNFQQNSQQNHQQNYQQNYPQKFPHQQNNITEDLVDIELSDSKESGSEYPQSVQQTHQ QPIQNNPSIPNNQPNQINQYNQQPNQYNHQQPNQFTQNQPNQPNQPNQHNQYSQHNQPNQ SNQPNQYNQNNQFAQPNQYNQSGQLNHTNKINKQIQKQLDKNQPEKIPSKPEKNQKQSHK PKLPPTMQHGPLPIHGMPIQHMPPQLPMQTEYCKKSNSLFDYIIIPIALVLVFLFLVHPK TFQNNW
Uniprot No.

Target Background

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What are the recommended storage and handling conditions for recombinant MIMI_R335 protein?

For optimal stability and activity maintenance, the recombinant MIMI_R335 protein should be stored according to these guidelines:

  • Store at -20°C/-80°C upon receipt, with aliquoting necessary for multiple uses

  • Avoid repeated freeze-thaw cycles as they can compromise protein integrity

  • Working aliquots can be stored at 4°C for up to one week

  • The protein is typically provided as a lyophilized powder in Tris/PBS-based buffer with 6% Trehalose at pH 8.0

  • For reconstitution, it is recommended to centrifuge the vial briefly before opening and reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Addition of glycerol to a final concentration of 5-50% (typically 50%) is recommended for long-term storage at -20°C/-80°C

These conditions help maintain protein stability and prevent aggregation or denaturation that could interfere with experimental results.

What experimental approaches can be used to characterize the function of MIMI_R335?

To characterize the function of this uncharacterized protein, a multi-faceted experimental approach is recommended:

  • RNA interference (RNAi): This has been successfully applied to other Mimivirus proteins. Design short interfering RNAs (siRNAs) targeting the MIMI_R335 gene to knock down its expression. Compare the phenotype of viruses with reduced R335 expression to wild-type viruses to identify functional deficits .

  • Protein-protein interaction studies: Perform co-immunoprecipitation or yeast two-hybrid assays to identify host or viral proteins that interact with MIMI_R335. This can provide clues about its function in the viral lifecycle.

  • Expression timing analysis: Use quantitative PCR to determine when during infection MIMI_R335 is expressed, which may indicate early (regulatory) or late (structural) function .

  • Localization studies: Generate antibodies against MIMI_R335 and use immunogold labeling with transmission electron microscopy to determine where the protein localizes within the virion or infected cell .

  • Microinjection experiments: Similar to work with other Mimivirus proteins, microinjection of purified R335 protein into Acanthamoeba cells, with or without viral DNA, could reveal roles in infection establishment .

When designing these experiments, include appropriate controls such as siRNAs targeting non-essential genes or unrelated proteins like L425 (capsid protein) to distinguish specific from non-specific effects .

How can I design an effective within-subjects experimental design to study MIMI_R335's impact on Acanthamoeba infection?

A proper within-subjects experimental design for studying MIMI_R335's impact would follow this structure:

  • Factor selection: Include multiple independent variables such as:

    • MIMI_R335 expression levels (normal, knocked down, over-expressed)

    • Time points post-infection (e.g., 1, 3, 5, 8 hours)

    • Presence/absence of host factors (if investigating interactions)

  • Full factorial design: Create a comprehensive experimental matrix covering all combinations of factors. For example, with 3 expression levels and 4 time points, you would have 12 experimental conditions .

  • Dependent variable selection: Measure relevant outcomes such as:

    • Viral replication efficiency (qPCR of viral DNA)

    • Host cell viability

    • Cytopathic effects

    • Expression levels of other viral or host genes

  • Control measures: Include appropriate controls:

    • Mock-infected cells

    • Cells infected with wild-type virus

    • Cells treated with control siRNA targeting non-essential genes

  • Randomization: Randomize the order of conditions to minimize sequence effects.

  • Sample size calculation: Perform power analysis to determine appropriate sample sizes for statistical significance.

Statistical analysis should include repeated measures ANOVA to account for the within-subjects design, with post-hoc tests to identify specific differences between conditions .

What proteomic approaches are most effective for analyzing potential post-translational modifications of MIMI_R335?

For comprehensive analysis of post-translational modifications (PTMs) of MIMI_R335, the following proteomic approaches are recommended:

  • 2D-DIGE (Two-Dimensional Difference Gel Electrophoresis): This has been effectively used with other Mimivirus proteins to detect shifts in protein expression and modification. Comparing wild-type to mutant or treated samples can reveal changes in PTM patterns .

  • Mass spectrometry approaches:

    • MALDI-TOF-MS for initial protein identification

    • LC-MS/MS for detailed peptide mapping and PTM identification

    • Targeted MS approaches for specific modifications of interest

  • Specific modification analyses:

    • Phosphorylation: Use phospho-specific antibodies and/or phospho-enrichment strategies prior to MS

    • Glycosylation: Use glycan-specific staining, enzymatic deglycosylation comparisons, and glycopeptide enrichment methods

    • Ubiquitination: Immunoprecipitation with ubiquitin-specific antibodies followed by MS analysis

  • Bioinformatic prediction and validation:

    • Use computational tools to predict likely PTM sites

    • Design site-directed mutagenesis of predicted PTM sites

    • Compare modified and unmodified forms functionally

When performing these analyses, maintain appropriate controls including unmodified recombinant protein and comparison to other Mimivirus proteins with known modifications .

How does MIMI_R335 potentially relate to other characterized proteins in Mimivirus, and what experimental approaches can test these relationships?

While MIMI_R335 remains uncharacterized, examining its potential relationships with other Mimivirus proteins can provide functional insights:

  • Sequence and structural comparison: Conduct bioinformatic analyses to identify sequence or structural similarities with characterized Mimivirus proteins such as fiber-associated proteins (R135, L725, L829, R856) , translation-related proteins (R458, L529, L496) , or collagen-like proteins (L71) .

  • Co-expression analysis: Design experiments to determine if MIMI_R335 is co-expressed with proteins of known function using quantitative RT-PCR at different time points during infection.

  • Functional clustering approach: Use RNA interference to knock down MIMI_R335 and perform comprehensive proteomic analysis to identify deregulated proteins. This approach revealed that silencing R458 (translation initiation factor) affected expression of 32 proteins, providing insight into functional relationships .

  • Protein complex identification: Use immunoprecipitation followed by mass spectrometry to identify proteins that interact with MIMI_R335. Compare results with known protein complexes in Mimivirus.

  • Viral factory localization studies: Determine if MIMI_R335 localizes to viral factories during infection, which would suggest roles in viral replication or assembly similar to other proteins that concentrate in these areas .

The experimental design should include appropriate controls and statistical analyses to distinguish specific interactions from non-specific associations common in large viruses.

What is the recommended protocol for investigating potential roles of MIMI_R335 in host-virus interactions during early infection stages?

To investigate MIMI_R335's potential role in early infection stages, implement this comprehensive protocol:

  • Temporal expression profiling:

    • Perform time-course analysis of MIMI_R335 expression using qRT-PCR at 0, 1, 2, 3, 4, 6, 8, and 12 hours post-infection

    • Compare expression pattern with known early and late viral genes to determine its expression timing

  • Antibody development and validation:

    • Generate polyclonal or monoclonal antibodies against recombinant MIMI_R335

    • Validate antibody specificity using Western blot and immunoprecipitation

  • Localization during entry:

    • Use immunofluorescence microscopy to track MIMI_R335 localization during early infection

    • Perform co-localization studies with markers of endocytic pathways

  • Functional inhibition experiments:

    • Design siRNAs targeting MIMI_R335

    • Transfect host cells with siRNAs prior to infection

    • Analyze effects on virus attachment, entry, and early gene expression

  • Host interaction screening:

    • Perform yeast two-hybrid or proximity labeling assays to identify host proteins interacting with MIMI_R335

    • Validate interactions using co-immunoprecipitation and determine if interactions occur during early infection

  • Complementation assays:

    • Using the microinjection technique described for other Mimivirus proteins , determine if purified MIMI_R335 can complement defects in viral DNA entry or early infection events

Include appropriate controls throughout, particularly comparing MIMI_R335 with known early infection proteins and using time-matched mock infections.

What are the critical factors for optimizing recombinant MIMI_R335 expression and purification?

Based on experience with similar viral proteins, several critical factors must be considered for optimal expression and purification:

  • Expression system selection:

    • E. coli is the established system for MIMI_R335 , but consider eukaryotic systems like insect cells if proper folding is an issue

    • If using E. coli, BL21(DE3) or Rosetta strains may improve expression of viral proteins with rare codons

  • Expression optimization:

    • Test multiple induction conditions (IPTG concentration, temperature, duration)

    • Optimal conditions often involve lower temperatures (16-25°C) and longer induction times for viral proteins

    • Consider auto-induction media for higher yields with less toxicity

  • Solubility enhancement:

    • If insolubility occurs, test fusion tags beyond His-tag (MBP, SUMO, or GST)

    • Addition of solubility enhancers like sorbitol or arginine to lysis buffer

    • Consider mild detergents if hydrophobic regions are present

  • Purification strategy:

    • Two-step purification recommended: IMAC (Ni-NTA) followed by size exclusion chromatography

    • Include reducing agents (1-5 mM DTT or β-mercaptoethanol) to prevent disulfide-mediated aggregation

    • Use salt gradient elution to separate differently charged species

  • Quality control:

    • Verify purity by SDS-PAGE (should exceed 90%)

    • Confirm identity by Western blot and mass spectrometry

    • Test functionality with appropriate activity assays

By systematically optimizing these factors, you can achieve high-quality recombinant MIMI_R335 suitable for downstream applications.

How should researchers address potential experimental artifacts when studying MIMI_R335 using RNAi approaches?

When using RNA interference to study MIMI_R335 function, several strategies can help distinguish genuine phenotypes from experimental artifacts:

  • siRNA design and validation:

    • Design multiple siRNAs targeting different regions of MIMI_R335 mRNA

    • Confirm knockdown efficiency by qRT-PCR and Western blot

    • Use appropriate controls including non-targeting siRNAs and siRNAs targeting non-essential genes

  • Off-target effect mitigation:

    • Perform BLAST analysis to ensure siRNA sequences don't target other viral or host genes

    • Use the lowest effective siRNA concentration to minimize off-target effects

    • Include rescue experiments with siRNA-resistant MIMI_R335 constructs

  • Phenotypic validation:

    • Verify phenotypes using complementary approaches (e.g., CRISPR/Cas9 if applicable, dominant negative mutants, or neutralizing antibodies)

    • Quantify phenotypes using multiple metrics to reduce measurement bias

    • Perform time-course experiments to distinguish primary from secondary effects

  • Controls for viral adaptation:

    • Compare immediate effects to longer-term outcomes to identify potential viral adaptation

    • Sequence the targeted region after multiple passages to detect potential escape mutations

  • Experimental design considerations:

    • Include internal controls in all experiments

    • Perform siRNA transfection in biological triplicates

    • Use viral production quantification methods such as qPCR and flow cytometry for objective assessment

These approaches help ensure that observed phenotypes represent genuine functions of MIMI_R335 rather than experimental artifacts.

What methodologies can be used to investigate potential interactions between MIMI_R335 and host cell proteins during infection?

To comprehensively investigate MIMI_R335-host protein interactions, employ these methodologies:

  • Affinity purification mass spectrometry (AP-MS):

    • Express tagged MIMI_R335 in infected or transfected cells

    • Purify protein complexes using tag-specific antibodies

    • Identify interacting partners by mass spectrometry

    • Validate hits with reciprocal pull-downs

  • Proximity-dependent approaches:

    • BioID: Express MIMI_R335 fused to a biotin ligase to biotinylate nearby proteins

    • APEX: Use MIMI_R335-APEX fusion to label proximal proteins with biotin

    • Analyze biotinylated proteins by streptavidin pull-down and mass spectrometry

  • Microscopy-based interaction studies:

    • Fluorescence Resonance Energy Transfer (FRET) to detect direct protein interactions

    • Proximity Ligation Assay (PLA) to visualize protein interactions in situ

    • Colocalization studies using confocal microscopy

  • Interactome analysis:

    • Compare MIMI_R335 interaction partners at different infection stages

    • Create interaction networks to identify key host pathways

  • Functional validation:

    • Knock down identified host interaction partners using siRNA

    • Generate point mutations in MIMI_R335 to disrupt specific interactions

    • Assess effects on viral replication and host response

These methods should be applied sequentially, starting with broad interaction discovery and progressing to focused validation of specific interactions most likely to be functionally significant.

How can researchers use comparative proteomics to identify potential functional similarities between MIMI_R335 and other mimivirus proteins?

Comparative proteomics offers powerful approaches to uncover functional insights for uncharacterized proteins like MIMI_R335:

  • 2D-DIGE differential analysis:

    • Compare proteomic profiles of wild-type mimivirus with MIMI_R335-silenced virus

    • Identify proteins with altered expression patterns

    • Compare these patterns with known profiles from other mimivirus protein knockdowns

    For example, silencing the translation initiation factor R458 resulted in deregulation of 32 proteins, with 48 downregulated and 35 upregulated peptide spots . By comparing MIMI_R335 knockdown patterns with this established profile, functional similarities can be identified.

  • Protein cluster analysis:

    • Group mimivirus proteins by expression timing during infection cycle

    • Determine which cluster MIMI_R335 belongs to

    • Proteins in the same cluster often share functional roles

  • Domain and motif analysis:

    • Perform detailed bioinformatic analysis of MIMI_R335 sequence

    • Compare with domains and motifs in characterized mimivirus proteins

    • Test predictions experimentally using domain deletion or mutation studies

  • Co-immunoprecipitation network analysis:

    • Generate a protein interaction network for MIMI_R335

    • Compare with interaction networks of characterized proteins

    • Identify overlapping interaction partners suggesting functional relationships

  • Response to experimental conditions:

    • Examine how MIMI_R335 expression changes under different conditions

    • Compare with expression patterns of characterized proteins

    • Similar responses often indicate functional relationships

This multi-layered approach can reveal functional connections not obvious from sequence analysis alone, particularly important for viral proteins that often evolve rapidly.

What statistical approaches are most appropriate for analyzing experimental data related to MIMI_R335 functional studies?

The statistical analysis of MIMI_R335 functional studies requires careful consideration of experimental design and data characteristics:

  • For gene expression studies:

    • Normalization: Use appropriate reference genes (validated housekeeping genes stable during infection)

    • Differential expression: Apply DESeq2 or edgeR for RNA-Seq data, paired t-tests or ANOVA for qPCR data

    • Multiple testing correction: Benjamini-Hochberg procedure to control false discovery rate

  • For time-course experiments:

    • Repeated measures ANOVA when comparing multiple conditions across time points

    • Mixed-effects models to account for both fixed and random effects

    • Time series analysis to identify patterns in temporal data

  • For protein-protein interaction studies:

    • Significance Analysis of INTeractome (SAINT) for scoring AP-MS data

    • Enrichment analysis to identify significantly over-represented interaction partners

    • Network analysis to identify clusters of functionally related proteins

  • For phenotypic assays:

    • Appropriate transformations (log, square root) for data not meeting normality assumptions

    • Non-parametric tests (Mann-Whitney U, Kruskal-Wallis) when parametric assumptions are violated

    • Analysis of Covariance (ANCOVA) when controlling for confounding variables

  • For microscopy and localization data:

    • Quantitative image analysis with appropriate controls

    • Colocalization statistics (Pearson's correlation, Manders' overlap coefficient)

    • Statistical comparison of distribution patterns

Sample size determination should be based on power analysis, typically aiming for 80% power at α=0.05, with effect sizes estimated from preliminary data or literature. For complex experiments, consult with a biostatistician during experimental design to ensure appropriate statistical approaches.

How should researchers interpret conflicting data regarding MIMI_R335 function in different experimental systems?

When faced with conflicting data about MIMI_R335 function, apply this systematic framework for resolution:

  • Experimental system comparison:

    • Catalog differences in host cell types, viral strains, and experimental conditions

    • Determine if conflicts arise from system-specific factors

    • Consider evolutionary differences if using different Acanthamoeba species

  • Methodological analysis:

    • Evaluate sensitivity and specificity of different methods

    • Assess temporal resolution (some methods may detect transient effects others miss)

    • Consider whether protein tags or expression systems introduce artifacts

  • Data integration approaches:

    • Weight evidence based on methodological rigor and reproducibility

    • Apply Bayesian analysis to update confidence in hypotheses as new data emerges

    • Create competing models and test which best explains all available data

  • Targeted validation experiments:

    • Design experiments specifically to resolve contradictions

    • Use orthogonal methods to verify key findings

    • Test boundary conditions where system differences might explain conflicting results

  • Consider biological complexity:

    • Proteins often have multiple functions depending on context

    • MIMI_R335 may play different roles at different infection stages

    • Post-translational modifications might alter function in different systems

A useful approach is to create a comprehensive table comparing all experimental conditions and results, similar to the one below:

Experimental SystemMethodMIMI_R335 ObservationControlsPotential ConfoundersReproducibility
A. polyphaga, Lab Strain AsiRNA knockdownReduced viral replicationNon-targeting siRNAOff-target effectsReplicated 3x
A. castellaniiProtein overexpressionNo effect on replicationEmpty vectorExpression timingSingle study
In vitro biochemicalRecombinant proteinDNA binding activityDenatured proteinTag interferenceReplicated 2x

This systematic analysis allows for identification of patterns explaining apparent contradictions and guides design of decisive experiments.

How can MIMI_R335 be used as a tool to understand host-pathogen interactions in the Acanthamoeba-Mimivirus system?

MIMI_R335 can serve as a valuable probe for investigating fundamental aspects of host-pathogen interactions:

  • As a marker for tracking infection dynamics:

    • Generate fluorescently tagged MIMI_R335 to visualize its localization during infection

    • Correlate its expression and distribution with key infection events

    • Use as a reporter for infection progression in high-throughput screening

  • As a tool for identifying host defense mechanisms:

    • Express MIMI_R335 in uninfected cells to identify host responses

    • Compare transcriptomes of cells expressing MIMI_R335 vs. other viral proteins

    • Identify host factors that specifically interact with or respond to MIMI_R335

  • For understanding viral adaptation:

    • Compare MIMI_R335 sequences across mimivirus strains from different environments

    • Correlate sequence variations with host range or virulence differences

    • Perform experimental evolution studies tracking MIMI_R335 mutations

  • For studying host cell remodeling:

    • Investigate MIMI_R335's potential role in cytoskeletal reorganization

    • Analyze its impact on host transcription and translation machineries

    • Examine effects on host organelle distribution and function

  • For comparative virology:

    • Use MIMI_R335 as a reference point to identify functional analogs in other giant viruses

    • Determine if similar proteins exist in smaller viruses with reduced genomes

    • Trace evolutionary relationships between viral protein families

This approach can reveal fundamental principles of viral manipulation of host cells, particularly in this unique system involving a giant virus and a single-celled eukaryotic host.

What are the critical considerations for designing experiments to test if MIMI_R335 contributes to the pathogenicity of Mimivirus in model systems?

Designing experiments to assess MIMI_R335's contribution to pathogenicity requires careful consideration of several factors:

  • Model system selection:

    • Primary model: Acanthamoeba culture systems (natural host)

    • Alternative models: Consider macrophage cell lines which can phagocytize mimivirus particles

    • Animal models: Only if strong preliminary evidence supports pathogenic potential

  • Gene manipulation approaches:

    • siRNA knockdown with validated efficiency measurement

    • Generation of MIMI_R335 deletion mutants if feasible

    • Complementation systems to confirm phenotypes are specifically due to MIMI_R335

  • Pathogenicity metrics:

    • Host cell viability and cytopathic effect quantification

    • Viral replication efficiency measurement

    • Host inflammatory response assessment

    • Cell cycle arrest analysis, as observed with other mimivirus proteins

  • Controls and standards:

    • Wild-type virus as positive control

    • Viruses with mutations in known virulence factors as benchmarks

    • Mock infections as negative controls

    • Include multiple virus preparations to account for stock variation

  • Experimental design considerations:

    • Dose-response relationships: Test multiple MOIs (multiplicities of infection)

    • Time course analyses: Capture both early and late effects

    • Replicates: Minimum of three biological replicates per condition

  • Methodological approach:

    • Use quantitative methods like flow cytometry and qPCR rather than subjective assessments

    • Include multiple independent measures of each outcome

    • Blind analysts to experimental conditions where possible

These design considerations will help produce robust, reproducible data on MIMI_R335's potential contribution to viral pathogenicity while minimizing experimental artifacts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.