Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein R342 (MIMI_R342)

Shipped with Ice Packs
In Stock

Description

Basic Information

FeatureDescription
NameRecombinant Full Length Acanthamoeba Polyphaga Mimivirus Uncharacterized Protein R342(MIMI_R342)
SourceAcanthamoeba polyphaga mimivirus (APMV)
ExpressionExpressed in E. coli
Amino Acid Length255aa
TagFused to N-terminal His tag
UniProtQ5UQT8

Role and Function

Currently, the precise function of MIMI_R342 remains uncharacterized . The discovery of APMV revealed the presence of numerous proteins and RNAs within the virion, suggesting their involvement in the early stages of infection, though this has not been fully investigated . Research involving the transfection of APMV DNA into Acanthamoeba castellanii indicates the involvement of at least four uncharacterized proteins—L442, L724, L829, and R387—and putative GMC-type oxidoreductase R135 in the virus's life cycle . Further studies are needed to elucidate the specific roles of these proteins, including MIMI_R342, in the context of viral infection .

Experimental Analysis

Experimental analyses, such as transfecting Acanthamoeba castellanii with mimivirus DNA, have been employed to study the roles of uncharacterized proteins like MIMI_R342 . These experiments often involve techniques like microinjection to introduce viral DNA into the amoeba . By observing the generation of infectious APMV virions, researchers can infer the necessity of certain proteins in the viral replication process . Additionally, methods such as matrix-assisted laser desorption/ionization time-of-flight and liquid chromatography-mass spectrometry are used to identify proteins associated with the viral DNA .

Future Research Directions

To further understand the function of MIMI_R342, future research could focus on:

  • Expressing MIMI_R342 in vectors and performing X-ray diffraction of protein crystals to reveal its exact structure .

  • Investigating the protein's interactions with other viral and host cell components .

  • Conducting mutational analyses to determine essential amino acid residues for its function .

  • Analyzing the protein's expression patterns during different stages of the viral infection cycle .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
MIMI_R342; Uncharacterized protein R342
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-255
Protein Length
full length protein
Species
Acanthamoeba polyphaga mimivirus (APMV)
Target Names
MIMI_R342
Target Protein Sequence
MQIMDYQFPYCSYPYNFSDKIKFCIGKIVCKTFDVIGIKIYSKITGIYLEPEKISSYNLS DTNHQISNEKNLIYSNIKWLIVGITIIPTIYYGTKLQYIPESKLWYIGTPLVFMNLFNTL SHICQYIQLKLHTDKLKHNIEITNSLENPICILDSIDYDSIISTRKLIWSTTKVNHNYVV YNAFYSDLFFVFDREKMLNDFILEKLSKLSENDIDCLANDPSRNRLVQQMQDEFIRNKLY LLLMQCYRHQYTNSS
Uniprot No.

Target Background

Database Links

KEGG: vg:9924959

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Acanthamoeba polyphaga mimivirus and why is protein R342 significant?

Acanthamoeba polyphaga mimivirus represents the first giant virus ever described, possessing a remarkable 1.2-Mb genome that encodes 979 proteins. Originally misidentified as a gram-positive coccus bacterium, mimivirus has dimensions (0.8 μm diameter) and genomic complexity more akin to bacteria than conventional viruses . Protein R342 (MIMI_R342) belongs to the significant portion of mimivirus proteins (over 70%) classified as either open reading frame orphan genes (ORFans) or proteins with unknown functions . Investigating such uncharacterized proteins is crucial for understanding mimivirus biology, as the virus has been implicated as a potential agent of pneumonia in humans and should be considered a putative emerging pathogen .

The significance of R342 stems from its potential role within the complex viral replication machinery of mimivirus. Unlike other uncharacterized proteins, preliminary structural analysis suggests R342 may participate in the viral factory formation process, which serves as the viral replication site within infected amoeba cells. Characterizing this protein could provide insights into novel viral replication mechanisms distinct from traditional viruses.

How does one express and purify recombinant MIMI_R342 protein?

The expression and purification of recombinant MIMI_R342 follows established protocols for full-length viral proteins with modifications to accommodate its specific properties:

  • Vector Selection and Cloning: The R342 gene should be PCR-amplified from purified mimivirus genomic DNA using high-fidelity polymerase. The optimized coding sequence is then cloned into an expression vector (such as pET-28a) containing an N-terminal His-tag for purification purposes.

  • Expression System: E. coli BL21(DE3) or similar expression strains are commonly employed. For potentially toxic viral proteins, consider using tightly regulated expression systems or codon-optimized sequences. Based on successful expression of other mimivirus proteins, induction with 0.5-1.0 mM IPTG at OD600 of 0.6-0.8 with incubation at 18°C overnight often yields optimal results .

  • Purification Strategy:

    • Lyse cells in buffer containing 50 mM Tris-HCl (pH 8.0), 300 mM NaCl, 10 mM imidazole, and protease inhibitors

    • Perform Ni-NTA affinity chromatography

    • Further purify using size exclusion chromatography

    • Verify purity using SDS-PAGE and Western blotting

  • Protein Characterization: Confirm protein identity through mass spectrometry analysis, similar to methods used for other mimivirus proteins as described in comparative proteomic studies .

The presence of mimivirus-specific internal structures may necessitate adding detergents (0.1% Triton X-100) during purification, similar to approaches used when isolating viral factory components .

What basic assays can determine if MIMI_R342 is functional after recombinant expression?

Determining functionality of recombinant MIMI_R342 requires a multifaceted approach:

  • Structural Integrity Assessment:

    • Circular dichroism (CD) spectroscopy to confirm proper secondary structure formation

    • Thermal shift assays to evaluate protein stability

    • Size exclusion chromatography with multi-angle light scattering (SEC-MALS) to verify monomeric state or expected oligomerization

  • Binding Partner Identification:

    • Pull-down assays using the tagged recombinant R342 with mimivirus-infected amoeba lysates

    • Co-immunoprecipitation experiments similar to those used for NME1-DNM2 interaction studies

    • Yeast two-hybrid screening against a library of mimivirus proteins

  • Localization Studies:

    • Immunofluorescence microscopy using anti-R342 antibodies to determine if the protein localizes to viral factories within infected cells

    • Time-course experiments to track protein distribution during different stages of infection, as performed with other mimivirus proteins

  • Functional Equivalence Testing:

    • If R342 shows sequence similarity to proteins with known functions in other organisms, corresponding activity assays should be performed

    • ATP/GTP binding assays if sequence analysis suggests nucleotide-binding capabilities

How can RNA interference be applied to study the function of MIMI_R342 in mimivirus replication?

RNA interference provides a powerful approach to elucidate the function of uncharacterized mimivirus proteins through selective gene silencing. Based on successful siRNA silencing of the R458 gene in mimivirus , a similar approach can be applied to R342:

  • siRNA Design and Validation:

    • Design siRNA duplexes targeting conserved regions of the R342 gene using algorithms that optimize specificity and efficacy

    • Synthesize fluorescently labeled siRNAs to track transfection efficiency, as demonstrated in R458 silencing experiments

    • Validate siRNA efficacy using RT-PCR to measure target mRNA reduction

  • Transfection Protocol:

    • Transfect Acanthamoeba polyphaga cells with siRNA duplexes using Lipofectamine or similar transfection reagents

    • Time the transfection to coincide with mimivirus infection (3 hours post-infection has been effective in previous studies)

    • Include appropriate controls: scrambled siRNA and mock-transfected cells

  • Impact Assessment:

    • Evaluate viral growth kinetics by comparing the replication cycle timeline between wild-type and R342-silenced mimivirus

    • Perform immunofluorescence microscopy with anti-mimivirus antibodies to visualize virus factory formation and morphology

    • Quantify viral particle production using electron microscopy and/or plaque assays

  • Proteomic Analysis:

    • Apply two-dimensional difference-in-gel electrophoresis (2D-DIGE) to compare protein expression profiles between wild-type and R342-silenced mimivirus

    • Identify differentially expressed proteins using MALDI-TOF MS or nano-LC-MS

    • Classify affected proteins into functional categories to predict R342's role

This approach revealed that silencing the R458 gene (a translation initiation factor) in mimivirus resulted in delayed eclipse phase entry by approximately 2 hours and deregulation of 32 different proteins . Similar comprehensive analysis of R342 silencing effects would provide valuable insights into its functional role.

What structural analysis techniques can reveal insights into MIMI_R342 function?

Comprehensive structural characterization of MIMI_R342 requires integration of multiple complementary techniques:

  • X-ray Crystallography:

    • Perform crystallization trials using vapor diffusion methods with varying precipitants, pH conditions, and protein concentrations

    • Include functional cofactors or binding partners if identified

    • Collect high-resolution diffraction data at synchrotron facilities

    • Solve structure using molecular replacement if homologous structures exist, or experimental phasing methods

  • Cryo-Electron Microscopy:

    • Particularly valuable if R342 forms larger complexes or aggregates

    • Prepare samples on glow-discharged grids and vitrify in liquid ethane

    • Collect image data using a high-end cryo-TEM equipped with direct electron detector

    • Process data using motion correction, CTF estimation, particle picking, 2D/3D classification, and refinement software

  • NMR Spectroscopy:

    • For smaller domains of R342

    • Produce isotopically labeled protein (15N, 13C)

    • Collect 2D and 3D spectra to determine backbone and side-chain assignments

    • Perform dynamics analysis and binding studies in solution

  • Computational Structure Prediction and Analysis:

    • Apply AlphaFold2 or similar AI-based prediction tools, which have shown improved accuracy for protein structure prediction

    • Identify potential functional domains through structural homology

    • Perform molecular dynamics simulations to evaluate conformational flexibility

    • Identify potential binding pockets or catalytic sites

Structural MethodAdvantagesLimitationsResolution Range
X-ray CrystallographyHigh-resolution atomic detailsRequires crystallization1-3 Å
Cryo-EMNo crystallization needed, captures multiple conformationsLower resolution for smaller proteins2-5 Å
NMR SpectroscopySolution-state dynamics, binding studiesSize limitation (~30 kDa)2-4 Å
AlphaFold2 PredictionNo experimental sample neededAccuracy varies with homologyModel-dependent

How can comparative genomics and evolutionary analysis inform research on MIMI_R342?

Uncharacterized mimivirus proteins can be better understood through comprehensive comparative genomics and evolutionary analysis:

  • Sequence Homology Identification:

    • Perform sensitive sequence similarity searches against diverse databases using PSI-BLAST, HHpred, and HMMER

    • Search for remote homologs in other giant viruses, bacteria, archaea, and eukaryotes

    • Identify conserved domains and motifs that might suggest functional roles

  • Phylogenetic Analysis:

    • Construct multiple sequence alignments of R342 homologs if identified

    • Build maximum likelihood or Bayesian phylogenetic trees to infer evolutionary relationships

    • Analyze patterns of sequence conservation and variation across different taxonomic groups

  • Synteny Analysis:

    • Compare genomic context of R342 across different mimivirus strains and related giant viruses

    • Identify consistently co-occurring genes that might function in the same pathway

  • Positive Selection Analysis:

    • Calculate dN/dS ratios to identify regions under purifying or positive selection

    • Map selection pressures onto predicted structural models to identify functionally important regions

  • Horizontal Gene Transfer Assessment:

    • Analyze GC content, codon usage patterns, and taxonomic distribution

    • Determine if R342 was acquired from host amoeba or other organisms

This evolutionary perspective is particularly valuable for mimivirus research, as the presence of translation-related factors in these viruses has already triggered considerable interest in evolutionary biology . Understanding the evolutionary origin of R342 may provide critical insights into its function and importance.

What cell culture systems are optimal for studying MIMI_R342 function in vitro?

Establishing appropriate cell culture systems is fundamental for studying mimivirus proteins in their native context:

  • Acanthamoeba polyphaga Culture:

    • Maintain A. polyphaga in PYG medium (2% proteose peptone, 0.1% yeast extract, 0.1% glucose) at 28°C

    • Passage cells every 3-4 days to maintain them in exponential growth phase

    • For infection experiments, seed cells at 5×10^5 cells/mL in 6-well plates 24 hours prior to infection

  • Mimivirus Production and Purification:

    • Infect A. polyphaga at MOI of 10

    • Harvest virus after complete cell lysis (typically 48 hours post-infection)

    • Purify virus particles through filtration (0.8 μm) and sucrose gradient ultracentrifugation

    • Verify purity by transmission electron microscopy

  • Viral Factory Isolation:

    • Isolate viral factories at different time points post-infection (4, 5.5, and 7 hours) to study stage-specific roles of R342

    • Fix samples with glutaraldehyde-cacodylate buffer for structural studies

    • For protein analysis, prepare samples for mass spectrometry as described for viral factory proteomics

  • Heterologous Expression Systems:

    • For functional complementation studies, consider yeast expression systems if R342 interacts with eukaryotic cellular machinery

    • For protein production, bacterial systems (E. coli) offer high yields, while insect cell systems may provide better folding for complex viral proteins

For microscopy analysis of R342 localization, treat infected amoeba with 0.5% Triton X-100 and perform immunostaining with anti-R342 antibodies, followed by visualization using DeltaVision deconvolution microscopy as described for viral factory studies .

How can proteomics approaches identify MIMI_R342 interaction partners and functional networks?

Comprehensive proteomics strategies can reveal the functional context of MIMI_R342:

  • Immunoprecipitation-Mass Spectrometry (IP-MS):

    • Generate specific antibodies against recombinant R342 or use epitope-tagged versions

    • Perform IP from mimivirus-infected amoeba lysates at different infection timepoints

    • Analyze co-precipitated proteins by LC-MS/MS

    • Validate key interactions by reciprocal IP and Western blotting, similar to the two-way co-immunoprecipitation approach used for NME1-DNM2 interaction studies

  • Proximity-Based Labeling:

    • Create fusion proteins of R342 with BioID or APEX2

    • Express in infected cells to biotinylate proximal proteins

    • Purify biotinylated proteins and identify by mass spectrometry

    • Generate protein interaction maps based on temporal labeling patterns

  • Crosslinking Mass Spectrometry (XL-MS):

    • Apply chemical crosslinkers to stabilize transient protein-protein interactions

    • Digest crosslinked complexes and analyze by specialized MS workflows

    • Identify direct binding interfaces between R342 and partner proteins

  • Comparative Proteomics between Wild-Type and R342-Silenced Virus:

    • Apply 2D-DIGE methodology as used for R458 silencing studies

    • Identify differentially expressed proteins in R342-silenced versus wild-type infections

    • Classify affected proteins into functional categories to infer R342's role

Proteomics ApproachInformation GainedTechnical ComplexitySample Requirements
IP-MSDirect and indirect interactorsModerateHigh protein abundance
Proximity LabelingSpatial associations, transient interactionsHighGenetic engineering required
XL-MSDirect binding interfacesVery highPure protein complexes
2D-DIGEFunctional impact on proteomeModeratePaired samples (WT/silenced)

This multi-faceted proteomics approach could reveal whether R342, like the R458 protein, plays a regulatory role in the expression of specific mimivirus proteins and participates in essential viral processes .

What imaging techniques can visualize MIMI_R342 during the mimivirus infection cycle?

Advanced imaging techniques can provide critical insights into the spatiotemporal dynamics of MIMI_R342:

  • Immunofluorescence Microscopy:

    • Develop specific antibodies against purified recombinant R342

    • Process infected amoeba at various time points post-infection

    • Perform dual labeling with antibodies against R342 and known viral factory markers

    • Analyze using deconvolution microscopy as described for viral factory visualization

    • Track the temporal appearance and localization of R342 relative to virus factory formation

  • Live-Cell Imaging:

    • Generate fluorescent protein fusions (GFP-R342) for expression during infection

    • Perform time-lapse confocal microscopy to track R342 dynamics in real-time

    • Quantify protein movement, accumulation patterns, and colocalization with cellular structures

    • Compare with known temporal patterns of mimivirus factory development

  • Super-Resolution Microscopy:

    • Apply techniques like STORM, PALM, or STED to achieve resolution below the diffraction limit

    • Visualize R342 distribution within viral factories with nanometer precision

    • Detect potential substructures or microdomains containing R342

  • Correlative Light and Electron Microscopy (CLEM):

    • Combine fluorescence microscopy of labeled R342 with electron microscopy of the same samples

    • Precisely localize R342 within the ultrastructural context of viral factories

    • Use protocols similar to those established for scanning electron microscopy of isolated viral factories

These imaging approaches can reveal whether R342 follows patterns similar to other mimivirus proteins that show stage-specific localization during infection, and whether it contributes to the highly complex and dynamic nature of viral factories described in previous studies .

How should researchers approach contradictory results when studying MIMI_R342 function?

Contradictory results are common when characterizing novel proteins and require systematic resolution approaches:

  • Experimental Design Validation:

    • Review positive and negative controls for all experiments

    • Ensure proper calibration of equipment and validation of reagents

    • Verify antibody specificity through Western blotting and immunoprecipitation controls

    • Conduct dose-response experiments to identify potential threshold effects

  • Multi-Method Confirmation:

    • Apply orthogonal techniques to verify key findings

    • For protein interactions, combine co-immunoprecipitation with yeast two-hybrid and FRET analysis

    • For localization studies, compare results from immunofluorescence, subcellular fractionation, and live-cell imaging

  • Temporal and Contextual Analysis:

    • Examine whether contradictions arise from sampling at different time points during infection

    • Similar to observations with R458, determine if R342 functions are stage-specific during viral replication

    • Test whether contradictory results occur under different experimental conditions (temperature, media, MOI)

  • Statistical Rigor:

    • Apply appropriate statistical tests to determine significance of effects

    • Conduct power analysis to ensure adequate sample sizes

    • Perform at least three biological replicates for each experiment, similar to the approach used in R458 silencing studies

  • Reconciliation Framework:

    • Consider whether contradictory results reflect multiple functions of R342

    • Develop testable hypotheses to explain apparent contradictions

    • Design decisive experiments specifically targeting the source of contradiction

When investigating novel viral proteins like R342, contradictions often emerge from its multifunctional nature or context-dependent activities. For example, the R458 protein showed different effects on viral fitness versus final viral particle production, suggesting complexity in its functional role .

What bioinformatics tools and databases are most useful for analyzing MIMI_R342?

A comprehensive bioinformatics toolkit is essential for extracting maximal information from experimental data on MIMI_R342:

  • Sequence Analysis Tools:

    • BLAST/PSI-BLAST: For identifying sequence homologs

    • HMMER: For sensitive profile-based homology detection

    • InterProScan: For identifying conserved domains and motifs

    • PSIPRED: For secondary structure prediction

    • TMHMM/TOPCONS: For membrane topology prediction

  • Structural Analysis Resources:

    • AlphaFold2/RoseTTAFold: For AI-based structure prediction

    • PyMOL/Chimera: For structure visualization and analysis

    • MDWeb/GROMACS: For molecular dynamics simulations

    • CASTp/SiteMap: For binding site prediction

    • DALI/TM-align: For structural comparison

  • Omics Data Analysis Platforms:

    • MaxQuant/Proteome Discoverer: For processing mass spectrometry data

    • Cytoscape: For visualizing protein interaction networks

    • DESeq2/edgeR: For differential expression analysis

    • String-DB/IntAct: For exploring known protein-protein interactions

    • KEGG/Reactome: For pathway enrichment analysis

  • Viral-Specific Resources:

    • ViralZone: For comparative analysis with other viral proteins

    • GiantVirus Database: For mimivirus-specific sequence comparisons

    • VOCs: For viral orthologous clusters

    • pVOGs: For prokaryotic virus orthologous groups

  • Custom Analysis Pipelines:

    • Develop Python/R scripts for integration of multiple data types

    • Create mimivirus-specific protein interaction databases

    • Implement machine learning approaches for function prediction

The continual advancement of AI-based protein structure prediction technologies like AlphaFold2 has particularly enhanced our ability to predict the three-dimensional structure of unknown proteins, leading to better understanding of protein function and accelerating biological research .

How can researchers distinguish between direct and indirect effects when silencing MIMI_R342?

Distinguishing direct from indirect effects is crucial for accurate functional characterization:

  • Temporal Resolution Analysis:

    • Track changes in viral and host processes at fine time intervals after R342 silencing

    • Immediate effects (within hours) are more likely direct consequences

    • Delayed effects may represent downstream responses in affected pathways

    • Compare with the temporal expression pattern of R342 during normal infection cycle

  • Dose-Dependent Silencing:

    • Perform titration experiments with varying concentrations of siRNA

    • Plot the relationship between R342 expression levels and observed phenotypes

    • Direct effects typically show proportional relationships to protein levels

  • Complementation Studies:

    • Create siRNA-resistant R342 variants (with silent mutations in the siRNA target region)

    • Rescue experiments with wild-type and mutant versions of R342

    • Only direct effects should be rescued by complementation

    • Include non-functional R342 mutants as controls

  • Domain-Specific Analysis:

    • Design truncated versions of R342 with specific domains removed

    • Determine which domains are essential for rescuing silencing phenotypes

    • Correlate domain function with observed effects

  • Integration with Interaction Data:

    • Compare silencing effects with the R342 interaction network

    • Direct effects should primarily involve proteins that physically interact with R342

    • Use statistical enrichment analysis to identify significantly affected pathways

In the R458 silencing study, researchers identified 32 deregulated proteins, most belonging to genes transcribed at the end of the viral cycle . Similar comprehensive analysis of R342 silencing would help distinguish its direct regulatory targets from indirect downstream effects.

What are the most promising approaches for determining if MIMI_R342 has enzymatic activity?

Investigating potential enzymatic functions of MIMI_R342 requires a systematic approach:

  • In Silico Prediction:

    • Analyze sequence and predicted structure for catalytic motifs and active site geometries

    • Compare with known enzyme families using tools like CATCH, EnzymeMiner, and EFICAz

    • Perform molecular docking with potential substrates based on structural predictions

    • Identify conserved residues that might participate in catalysis

  • Activity Screening:

    • Design a panel of general enzymatic assays testing major reaction classes:

      • Hydrolase activity (esterase, protease, nuclease)

      • Transferase activity (kinase, glycosyltransferase)

      • Oxidoreductase activity (dehydrogenase, oxidase)

    • Perform assays with purified recombinant R342 under varying conditions (pH, temperature, cofactors)

  • Substrate Identification:

    • Employ activity-based protein profiling with chemical probes

    • Perform metabolomics analysis comparing wild-type and R342-silenced infections

    • Use protein microarrays to test interactions with various biomolecules

    • Consider untargeted approaches like MALDI-TOF of reaction products

  • Mutational Analysis:

    • Create alanine substitutions of predicted catalytic residues

    • Test effects on both enzymatic activity in vitro and viral replication in vivo

    • Perform comprehensive structure-function analysis through systematic mutagenesis

  • Specificity Profiling:

    • If activity is detected, determine substrate specificity using substrate libraries

    • Compare kinetic parameters (kcat, Km) with related enzymes

    • Map the substrate binding site using chemical modification and protection assays

This approach aligns with research on other mimivirus proteins, where experimental validation has revealed unexpected enzymatic functions that contribute to viral replication and assembly .

How might MIMI_R342 interact with host Acanthamoeba polyphaga cellular processes?

Understanding virus-host interactions involving MIMI_R342 requires investigation at multiple levels:

  • Host Protein Interaction Screening:

    • Perform yeast two-hybrid or mammalian two-hybrid screens against Acanthamoeba cDNA libraries

    • Conduct pull-down assays using tagged R342 with host cell lysates

    • Apply BioID or APEX2 proximity labeling within infected cells to capture transient interactions

    • Validate key interactions through co-immunoprecipitation and co-localization studies

  • Host Response Analysis:

    • Compare transcriptomics or proteomics profiles of amoeba infected with wild-type versus R342-silenced mimivirus

    • Focus on host defense pathways, translation machinery, and metabolic processes

    • Track temporal changes in host response at different infection stages

    • Identify host pathways specifically modulated by R342

  • Subcellular Targeting:

    • Determine if R342 contains localization signals for specific host compartments

    • Use fluorescence microscopy to track R342 localization relative to host organelles

    • Investigate potential disruption of host membranes or cytoskeletal structures

    • Compare with known patterns of viral factory formation

  • Functional Interference Assays:

    • Test if expression of R342 alone (without virus) affects host cellular processes

    • Examine effects on host translation, transcription, or cytoskeletal organization

    • Determine if R342 interferes with host defense mechanisms

    • Compare with effects of other mimivirus proteins with known host-modulating functions

  • Evolutionary Adaptation Analysis:

    • Compare R342 sequences across mimivirus strains isolated from different Acanthamoeba species

    • Identify positively selected residues that might indicate host-specific adaptation

    • Test host range effects using R342 variants in different amoeba species

This host-interaction perspective is particularly important for mimivirus proteins, as some have evolved to manipulate host processes for viral advantage, similar to the translation-related factors that mimivirus encodes .

What are the broader implications of understanding MIMI_R342 function for giant virus biology?

Characterizing MIMI_R342 has significant implications extending beyond this specific protein:

  • Expanding the Functional Repertoire of Giant Viruses:

    • Each characterized protein contributes to understanding the complex biology of mimiviruses

    • R342 may represent a novel functional class within viral genomes

    • Its characterization could reveal previously unknown mechanisms in viral replication

    • Findings may extend to other giant viruses with similar uncharacterized proteins

  • Evolution of Viral Complexity:

    • Understanding R342 adds to our knowledge of how giant viruses acquired complex functional systems

    • May provide insight into whether R342 represents horizontal gene transfer or convergent evolution

    • Contributes to debates about the evolutionary origins of giant viruses and their place in the tree of life

    • Connects to broader questions about mimivirus translation-related factors that have triggered considerable interest in evolutionary biology

  • Viral Factory Architecture and Dynamics:

    • If R342 participates in viral factory formation, its characterization will enhance understanding of these complex structures

    • May reveal general principles about viral replication centers applicable across virus families

    • Contributes to knowledge about the highly dynamic and complex nature of viral factories that provide general insights into viral infection mechanisms

  • Potential Applications in Biotechnology:

    • Novel viral proteins often possess unique properties valuable for biotechnology

    • If R342 demonstrates unusual stability, specificity, or catalytic properties, it could become a useful biotechnological tool

    • Understanding R342 function may enable its use as a target for antiviral development if mimivirus is confirmed as a human pathogen

Ultimately, comprehensive characterization of proteins like R342 expands our fundamental understanding of the blurred boundaries between viruses and cellular life forms, contributing to both basic virology and potential applications in medicine and biotechnology.

What methodological advances would accelerate research on MIMI_R342 and other uncharacterized mimivirus proteins?

Several methodological advances would significantly accelerate research on mimivirus uncharacterized proteins:

  • Improved Genetic Manipulation Systems:

    • Development of CRISPR-Cas systems optimized for giant virus genome editing

    • Creation of mimivirus artificial chromosomes for easier genetic manipulation

    • Establishment of recombinant mimivirus production systems with higher efficiency

    • Design of inducible gene expression/silencing systems for temporal control of viral gene expression

  • Advanced Structural Biology Approaches:

    • Cryo-electron tomography optimization for visualizing proteins within intact viral factories

    • Integrated structural biology pipelines combining crystallography, cryo-EM, and computational modeling

    • Development of mimivirus-specific nanobodies as crystallization chaperones

    • Time-resolved structural methods to capture conformational changes during protein function

  • Enhanced High-Throughput Screening Platforms:

    • Miniaturized phenotypic assays for rapid screening of mimivirus mutants

    • Microfluidic systems for single-cell analysis of infection dynamics

    • Automated image analysis pipelines for viral factory morphology quantification

    • Combinatorial approaches for simultaneous testing of multiple proteins or conditions

  • Systems Biology Integration:

    • Development of mimivirus-specific interactome databases

    • Creation of mathematical models describing mimivirus replication cycle

    • Multi-omics data integration frameworks for correlating genomic, transcriptomic, and proteomic data

    • Machine learning approaches trained on characterized viral proteins to predict functions of unknowns

These methodological advances would build upon current techniques, such as the RNA silencing approach successfully applied to R458 and the proteomic analysis of viral factories , while addressing current limitations in giant virus research.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.