Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein R398 (MIMI_R398)

Shipped with Ice Packs
In Stock

Description

Introduction to Acanthamoeba polyphaga mimivirus

Acanthamoeba polyphaga mimivirus (APMV) stands as one of the most remarkable viral discoveries in recent decades. With an unusually large diameter and a 1.2-Mb double-stranded DNA genome encapsulating 979 proteins, mimivirus challenges traditional definitions separating viruses from cellular life forms . Initially misidentified as a bacterium due to its Gram-positive staining fibers, mimivirus was eventually recognized as a novel viral entity .

The mimivirus genome contains an extraordinary arsenal of genes, with more than 70% either classified as open reading frame orphan genes (ORFans) or having unknown functions . Perhaps most notably, mimivirus possesses genes encoding functions never previously encountered in viruses, including components of the translation apparatus, triggering considerable interest in evolutionary biology .

Current Research Applications

The mimivirus proteome, including uncharacterized proteins like MIMI_R398, has been the subject of comparative proteomic studies using techniques such as two-dimensional difference-in-gel electrophoresis (2D-DIGE) . Such approaches have helped identify proteins with regulated expression during viral infection cycles.

In a significant study examining the effects of silencing the mimivirus translation initiation factor R458, researchers observed deregulation of 32 viral proteins, demonstrating the interconnected nature of the mimivirus proteome . While MIMI_R398 was not specifically highlighted in these results, such studies establish precedent for investigating functional roles of previously uncharacterized mimivirus proteins.

Environmental sampling from the Sargasso Sea has identified sequences with similarities to mimivirus genes, suggesting the presence of previously unidentified mimivirus relatives in marine environments . Such environmental genomics approaches may eventually provide additional context for understanding the role of proteins like MIMI_R398 in diverse viral populations.

Potential Functions and Evolutionary Significance

While direct experimental evidence for MIMI_R398 function remains limited, contextual information provides several hypotheses. The designation as a putative phosphoesterase suggests potential involvement in nucleic acid metabolism or signaling pathways . Phosphoesterases typically catalyze the hydrolysis of phosphoester bonds, which are prevalent in DNA, RNA, and phosphorylated proteins.

The mimivirus R135 protein, another component of the viral outer surface, has been structurally characterized and shows similarity to aryl alcohol oxidase, potentially playing a role in degrading lignin in plant cell walls . This finding has led to speculation that the natural hosts of mimiviruses might include lignin-containing algae . By analogy, surface proteins like MIMI_R398 might similarly participate in host recognition or entry.

The evolutionary significance of mimivirus proteins extends beyond their immediate functions. The presence of translation-related genes and enzymes typically associated with cellular life forms has fueled debates about viral origins and their relationship to the emergence of eukaryotic cells . Detailed characterization of proteins like MIMI_R398 may contribute valuable data points to these broader evolutionary discussions.

Future Research Directions

Several promising research directions could enhance understanding of MIMI_R398:

  1. Structural determination: High-resolution structural studies using X-ray crystallography or cryo-electron microscopy would provide invaluable insights into potential functions.

  2. Gene silencing experiments: Following the methodological approach used for R458 , RNA silencing of MIMI_R398 could reveal effects on viral replication, protein expression patterns, and fitness.

  3. Interaction studies: Techniques such as co-immunoprecipitation, yeast two-hybrid assays, or proximity labeling could identify interaction partners, potentially placing MIMI_R398 within specific viral or host cellular pathways.

  4. Enzymatic assays: Given the putative phosphoesterase designation, targeted enzymatic assays with various potential substrates could confirm and characterize enzymatic activity.

  5. Localization studies: Immunolocalization of MIMI_R398 during the viral infection cycle could provide valuable context for understanding its biological role.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MIMI_R398; Uncharacterized protein R398
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-252
Protein Length
full length protein
Species
Acanthamoeba polyphaga mimivirus (APMV)
Target Names
MIMI_R398
Target Protein Sequence
MIFFDMMHNKASKHGGAVYSLLGNHELMNTQGNFDYVSYENYHNFDYDSPSGEKYTGSLG RQNVFKPGSNFVKKMACNRLSVLVIGSTMFTHAGVLPVLARKLDKLDLDSNKKLEYLNMI VRKWLLNKLSGKQDEEYKSLFINDTKISPFWNRIYGMIPNNTSIDSDQCFNSVKKTLQVF KIGKIVVGHTPQLFTNKDGINGTCYERGEDNKLYRIDGGFADAFNAFNKKHVVQVLEITD DKYFRIITSKKN
Uniprot No.

Target Background

Database Links

KEGG: vg:9925019

Subcellular Location
Host membrane; Single-pass membrane protein. Virion.

Q&A

How does MIMI_R398 compare to other proteins in the Mimivirus genome?

While direct comparative data for MIMI_R398 is limited in the provided research, we can contextualize it within the broader Mimivirus protein landscape. The Mimivirus genome encodes multiple proteins with diverse functions, including those involved in genome translocation, host replication blocking, and hijacking cell machinery. Additionally, some proteins play roles in virus protection from oxidative stress and chemotaxis .

Unlike the well-studied R349 gene, which has been demonstrated to have a critical role in the MIMIVIRE defense system against Zamilon virophage infection, the specific role of R398 remains largely uncharacterized . Future comparative proteomic studies would be valuable to establish functional relationships between R398 and other Mimivirus proteins.

What are the optimal conditions for expression and purification of recombinant MIMI_R398?

Based on available product information for recombinant MIMI_R398, researchers should consider the following parameters when designing expression and purification protocols:

  • Storage conditions: The recombinant protein is typically stored in a Tris-based buffer with 50% glycerol, optimized specifically for this protein.

  • Temperature considerations: For short-term storage, maintain at -20°C; for extended storage, conserve at either -20°C or -80°C.

  • Handling precautions: Repeated freezing and thawing should be avoided. Working aliquots can be stored at 4°C for up to one week .

For expression systems, researchers should consider the specific tag used during production, as this will influence purification strategies. The tag type is typically determined during the production process and should be verified for each batch of recombinant protein .

How can researchers design effective knockout experiments for studying MIMI_R398 function?

Drawing from methodologies used for R349 gene studies, researchers can design knockout experiments for MIMI_R398 using homologous recombination techniques. The following protocol outline is based on successful Mimivirus genomic editing approaches:

  • Design and construction of plasmid: Create a plasmid containing a marker gene (such as eGFP) flanked by upstream and downstream sequences of the MIMI_R398 gene to facilitate homologous recombination.

  • Transfection: Infect Acanthamoeba castellanii with wild-type Mimivirus, then transfect the infected cells with the constructed plasmid.

  • Screening and selection: Use flow cytometry to screen and sort fluorescent viral factories, indicating successful recombination events.

  • Validation: Confirm gene knockout using:

    • PCR with primers targeting regions upstream and downstream of the insertion site

    • Sequencing of PCR products to verify correct insertion

    • Functional assays to assess phenotypic changes

It's important to note that current techniques may result in unstable transformants, as observed with R349-KO viruses. Therefore, developing selective pressure systems would be beneficial for obtaining stable transformed viruses .

What potential roles might MIMI_R398 play in viral replication and host interaction?

While the specific function of MIMI_R398 remains uncharacterized, its potential roles can be hypothesized within the context of Mimivirus biology:

Mimivirus replication occurs exclusively in the cytoplasm but depends on host nuclear factors. During infection, nuclear factors necessary for replication are transferred via vesicles from the nucleus to the cytoplasm, creating a "viral factory" that facilitates viral genome replication and expression .

Based on this information, MIMI_R398 might be involved in:

  • Host cell interaction: Potentially participating in the transfer of nuclear factors to the viral factory

  • Viral factory formation or function: Contributing to the transcriptional and translational mechanisms that copy the viral genome

  • Host defense evasion: Similar to other viral proteins that help mitigate host immune responses

Future research utilizing techniques such as protein interaction studies, localization experiments, and functional assays during different stages of viral infection could help elucidate the specific roles of MIMI_R398.

How might MIMI_R398 compare to defense systems like MIMIVIRE?

The MIMIVIRE system, identified in lineage A Mimiviruses, represents a defense mechanism against Zamilon virophage infection. This system includes the R349 gene, which contains four 15 bp repeats homologous to virophage sequences .

While there is no direct evidence in the provided research linking MIMI_R398 to viral defense systems, researchers could investigate potential similarities or differences:

  • Sequence analysis: Examine MIMI_R398 for repeat sequences similar to those found in R349, which might suggest involvement in nucleic acid recognition.

  • Interaction studies: Investigate whether MIMI_R398 interacts with known components of the MIMIVIRE system, such as the helicase and nuclease associated with R349.

  • Differential expression: Analyze expression patterns of MIMI_R398 during virophage infection compared to normal infection conditions.

  • Knockout studies: Similar to the R349 knockout experiments, researchers could develop MIMI_R398 knockouts to assess susceptibility to various virophages or other viral challenges .

How can researchers address contradictory findings related to MIMI_R398 function?

When encountering contradictory findings in research related to MIMI_R398 or other Mimivirus proteins, researchers should employ systematic approaches to resolve these contradictions:

  • Context analysis: Many apparent contradictions in biomedical literature stem from incomplete context specifications. Researchers should carefully examine experimental conditions, including:

    • Species differences

    • Temporal context variations

    • Environmental phenomena

  • Standardized terminology: Ensure consistent gene/protein normalization to account for lexical variability in terminology .

  • Experimental design assessment: Evaluate the experimental designs used in contradictory studies. Consider whether differences in design might explain the contradictory results . Key aspects to assess include:

    • Interventions

    • Randomization methods

    • Control group selection and handling

    • Sample sizes and statistical power

  • Relation type analysis: When analyzing literature-derived claims, categorize the relation types (e.g., excitatory, inhibitory) to identify the nature of the contradiction .

What bioinformatic approaches are most effective for predicting MIMI_R398 function?

Given the uncharacterized nature of MIMI_R398, researchers can employ several bioinformatic strategies to predict its potential functions:

  • Sequence homology analysis: Compare the MIMI_R398 sequence against characterized proteins using tools like BLAST to identify potential functional homologs.

  • Structural prediction: Utilize protein structure prediction tools to generate 3D models that might provide insights into functional domains.

  • Motif identification: Search for conserved motifs that may indicate specific biochemical activities or interaction capabilities.

  • Evolutionary analysis: Examine the conservation of MIMI_R398 across different Mimivirus strains and related giant viruses to assess its evolutionary importance.

  • Integration with experimental data: Combine bioinformatic predictions with experimental data from protein-protein interaction studies, localization experiments, or expression analyses to refine functional hypotheses.

What controls are essential when studying recombinant MIMI_R398 in experimental systems?

When designing experiments with recombinant MIMI_R398, researchers should incorporate several critical controls:

  • Expression vector controls: Include empty vector controls to account for effects of the expression system itself.

  • Tag controls: If the recombinant protein contains tags (determined during the production process), researchers should include appropriate tag-only controls to distinguish protein-specific effects from tag-related artifacts .

  • Wild-type Mimivirus infection: For functional studies, comparison with wild-type Mimivirus infection provides essential baseline data .

  • Revertant controls: In knockout or modification studies, generating revertant viruses (where the modified gene is restored) provides powerful validation of phenotype-genotype relationships, as demonstrated in R349 studies .

  • Time-course controls: Given that Mimivirus infection leads to host cell death within approximately 16 hours, time-course experiments with appropriate sampling points are crucial for capturing the dynamics of MIMI_R398 activity .

How can researchers validate the specificity of antibodies or other detection reagents for MIMI_R398?

Ensuring detection specificity is critical for reliable experimental outcomes. Researchers can validate reagents for MIMI_R398 detection through:

  • Western blotting: Using recombinant MIMI_R398 protein as a positive control to confirm antibody specificity and determine optimal working concentrations.

  • Immunoprecipitation followed by mass spectrometry: This approach can confirm that the antibody is capturing the intended protein rather than cross-reacting with host or other viral proteins.

  • Knockout controls: Using MIMI_R398 knockout viruses (once developed) as negative controls to confirm detection specificity.

  • Peptide competition assays: Pre-incubating antibodies with purified recombinant MIMI_R398 or specific peptides should abolish specific signal in detection assays.

  • Cross-reactivity testing: Evaluating potential cross-reactivity with related viral proteins or host proteins to ensure signal specificity.

What are the most promising approaches for determining the function of uncharacterized proteins like MIMI_R398?

Determining the function of uncharacterized viral proteins like MIMI_R398 requires a multi-faceted approach:

  • CRISPR-Cas9 genomic editing: Building on the homologous recombination techniques used for R349, researchers could employ CRISPR-Cas9 technology to create more stable MIMI_R398 knockout or modified viruses .

  • Protein interactome mapping: Identifying host and viral protein interaction partners can provide functional insights through guilt-by-association.

  • Temporal expression analysis: Characterizing when MIMI_R398 is expressed during the viral life cycle can suggest functional roles in specific stages of infection.

  • Subcellular localization studies: Determining where MIMI_R398 localizes during infection (e.g., viral factory, host nucleus, cytoplasm) will provide valuable functional clues.

  • Structural biology approaches: X-ray crystallography or cryo-EM studies of MIMI_R398 could reveal structural features indicative of specific functions.

  • Comparative genomics: Analyzing MIMI_R398 homologs across different giant virus families may reveal evolutionarily conserved functions.

How might understanding MIMI_R398 contribute to broader knowledge about giant virus biology?

Characterizing MIMI_R398 has potential to advance several aspects of giant virus biology:

  • Evolutionary insights: Determining the function of uncharacterized proteins helps complete our understanding of the giant virus proteome and its evolutionary history.

  • Host-virus interaction: Many viral proteins play roles in modulating host cell processes; MIMI_R398 characterization may reveal novel host interaction mechanisms.

  • Viral replication mechanisms: If MIMI_R398 participates in the viral factory formation or function, its study could enhance our understanding of the unique replication strategies employed by giant viruses .

  • Potential applications: Deeper understanding of giant virus proteins may lead to applications in biotechnology, synthetic biology, or development of antiviral strategies.

  • Fundamental virology concepts: Giant viruses like Mimivirus challenge traditional definitions of viruses; characterizing their complex proteomes contributes to evolving concepts in virology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.