Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein R401 (MIMI_R401)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a reference for your application.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a particular tag, please inform us, and we will prioritize its development.
Synonyms
MIMI_R401; Uncharacterized protein R401
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-226
Protein Length
full length protein
Species
Acanthamoeba polyphaga mimivirus (APMV)
Target Names
MIMI_R401
Target Protein Sequence
MIRILSLNLIGLACGIGLYYDFQNRKHFKEVIDNNIPINGNNIITGTITCENTDIDNIFV HDRLPIPYSMSEDPFSLFELHGKNKIKFYDCDNYYYNDGLRQKYFKIGTVKYFDLWYIED NFYVEKSNIKINGINLIYDKNLKIFYPKHDYHYLNSNKYLVRKHIPNNSNVTAFGKINKY GMIKIESIGDSYNVIDYVAEKYFGISDIYTSTLSFGLIISLFYLLK
Uniprot No.

Target Background

Database Links

KEGG: vg:9925022

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is Acanthamoeba polyphaga mimivirus and its significance in research?

Acanthamoeba polyphaga mimivirus (APMV) is one of the largest known viruses, first discovered in 2003. It infects Acanthamoeba species and possesses a complex double-stranded DNA genome of approximately 1.2 million base pairs encoding over 900 proteins. The virus received its name "mimivirus" for "mimicking microbe" due to its unusually large size for a virus, with a capsid diameter of about 500 nm . Its discovery has significantly impacted our understanding of viral evolution and complexity, particularly regarding the presence of numerous proteins and RNAs within the virion that may be involved in early stages of infection .

How does R401 compare to other characterized uncharacterized proteins in mimivirus?

While specific information about R401 is not directly provided in the current literature, we can compare it to other uncharacterized mimivirus proteins like L442, L724, L829, and R387 that have been studied. These proteins have been shown to associate with viral DNA and appear to be essential for viral production . Proteins like L442 appear to play major roles in protein-DNA interactions necessary for mimivirus replication . R401 likely has distinct structural features compared to these proteins, potentially indicating specialized functions within the viral life cycle.

What basic techniques are used to identify and isolate mimivirus proteins?

The identification and isolation of mimivirus proteins typically involves several complementary approaches:

  • Genomic analysis to identify open reading frames

  • Recombinant protein expression in suitable host systems

  • Protein extraction from viral particles using gradient centrifugation

  • Affinity chromatography for tagged recombinant proteins

  • Mass spectrometry for protein identification

For studying DNA-associated proteins specifically, techniques similar to those used for L442, L724, L829, and R387 are applicable, including SDS-PAGE analysis, in-gel digestion, and matrix-assisted laser desorption/ionization time-of-flight mass spectrometry (MALDI-TOF-MS) . These approaches revealed that proteins like L442 remain associated with viral DNA even after standard extraction procedures .

What expression systems are most effective for producing recombinant MIMI_R401?

Based on successful approaches with other mimivirus proteins, the following expression systems should be considered:

Expression SystemAdvantagesDisadvantagesBest Application
E. coli (BL21(DE3))High yield, cost-effective, rapidLimited post-translational modificationsInitial structural studies
Yeast (P. pastoris)Eukaryotic modifications, secretionLower yield than E. coliIf E. coli expression fails
Insect cells (Baculovirus)Complex protein folding, higher fidelityTime-consuming, expensiveFunctional studies requiring authentic folding
Cell-free systemsRapid, handles toxic proteinsLower yield, expensiveInitial screening of conditions

For proteins associated with DNA like those described in the mimivirus literature, E. coli expression with specialized vectors containing solubility-enhancing tags is often the starting point due to high yield and simplicity .

What purification challenges are specific to MIMI_R401 and how can they be addressed?

While specific challenges for R401 are not documented, proteins that associate with DNA like L442 present common purification challenges:

  • DNA contamination: If R401 binds DNA like L442, standard purification may co-purify nucleic acids. This can be addressed through:

    • DNase treatment during lysis

    • High salt washes (>500 mM NaCl) to disrupt DNA-protein interactions

    • Heparin affinity chromatography as a DNA-mimetic purification step

  • Protein solubility: Viral proteins often have hydrophobic regions that reduce solubility. Solutions include:

    • Fusion with solubility-enhancing tags (MBP, SUMO)

    • Addition of mild detergents (0.05% Tween-20)

    • Optimization of buffer conditions using thermal shift assays

  • Protein stability: Maintaining native structure through purification requires:

    • Inclusion of reducing agents (DTT or TCEP)

    • Working at controlled temperatures (typically 4°C)

    • Immediate analysis or storage at -80°C with cryoprotectants

As observed with L442, sometimes maintaining protein-DNA interactions can be critical for function, so proteinase K treatment can eliminate essential protein elements required for viral production .

What computational approaches should be used to predict MIMI_R401 structure?

For uncharacterized mimivirus proteins like R401, a multi-tiered computational approach is recommended:

  • Initial sequence analysis:

    • Position-specific scoring matrices to identify remote homologs

    • Secondary structure prediction using PSIPRED and JPred

    • Disorder prediction via PONDR and DISOPRED

  • Advanced structure prediction:

    • AlphaFold2 for high-confidence tertiary structure prediction

    • Robetta for alternative models and validation

    • The Phyre2 tool (as used for L442, L724, L829, and R387) for template-based modeling

  • Functional inference:

    • Active site prediction using CASTp or COACH

    • Electrostatic surface analysis to identify potential DNA-binding regions

    • Molecular dynamics simulations to assess stability and flexibility

Researchers should note that even with modern prediction tools, experimental validation remains essential, particularly for proteins like mimivirus R401 that may have unique structural features with few close homologs.

What experimental methods are most appropriate for resolving MIMI_R401 structure?

The selection of experimental methods should be based on the characteristics of R401 and available resources:

  • X-ray crystallography:

    • Most appropriate for stable, soluble proteins that form crystals

    • Requires significant amounts of purified protein (>10 mg)

    • Provides high-resolution structures (potentially 1.5-2.5 Å)

    • Challenging for proteins with flexible regions

  • Nuclear Magnetic Resonance (NMR):

    • Suitable for smaller proteins or domains (<25 kDa)

    • Provides information on dynamics and conformational changes

    • Requires isotopically labeled protein (15N, 13C)

    • Works well in solution, avoiding crystallization challenges

  • Cryo-Electron Microscopy:

    • Appropriate for larger complexes (>100 kDa)

    • Can reveal R401 in the context of larger viral assemblies

    • Doesn't require crystallization

    • Recent advances allow near-atomic resolution

  • Small-Angle X-ray Scattering (SAXS):

    • Provides low-resolution envelope of protein shape

    • Useful for validating computational models

    • Works in solution with minimal sample preparation

    • Can be combined with other structural data

For DNA-binding proteins like those identified in mimivirus, a combination of methods often yields the most comprehensive structural insights .

How can we experimentally determine if MIMI_R401 interacts with viral DNA?

To assess R401's potential DNA-binding properties, similar to proteins like L442 identified in mimivirus research , the following systematic approach is recommended:

  • Preliminary binding assessment:

    • Electrophoretic mobility shift assays (EMSA) with viral DNA fragments

    • Filter binding assays to quantify binding affinity

    • UV cross-linking followed by SDS-PAGE to confirm direct interaction

  • Binding specificity determination:

    • Competition assays with different DNA sequences

    • DNase I footprinting to identify protected regions

    • Systematic evolution of ligands by exponential enrichment (SELEX) to identify optimal binding sequences

  • Structural characterization of complexes:

    • X-ray crystallography of R401-DNA complexes

    • Cryo-EM of larger assemblies

    • NMR chemical shift perturbation to map binding interfaces

  • In vivo validation:

    • Chromatin immunoprecipitation (ChIP) during viral infection

    • Fluorescence microscopy with labeled R401 and DNA

    • DNA transfection experiments with and without R401

The transfection approach used for mimivirus DNA, where proteinase K treatment prevented successful viral replication, provides a model for testing R401's potential role in DNA-protein complexes essential for viral function .

What experimental design would best determine R401's role in the viral life cycle?

A comprehensive experimental design would include:

  • Gene manipulation studies:

    • CRISPR-Cas9 genome editing to create R401 knockouts

    • Construction of R401 mutants with altered domains

    • Complementation assays to confirm phenotypes

  • Temporal expression analysis:

    • RT-qPCR to track R401 expression during infection

    • Western blotting to monitor protein levels

    • Fluorescence microscopy with tagged R401 to observe localization

  • Protein interaction network:

    • Immunoprecipitation-mass spectrometry to identify binding partners

    • Yeast two-hybrid screening for protein-protein interactions

    • Protein microarrays to detect multiple interactions simultaneously

  • Viral production assessment:

    • Transfection experiments similar to those used for L442

    • Plaque assays to quantify infectious virion production

    • Electron microscopy to observe virion morphology

  • Host response analysis:

    • Transcriptomics to identify regulated host genes

    • Proteomics to detect changes in host protein levels

    • Phosphoproteomics to identify signaling pathways affected

This multi-faceted approach would provide complementary lines of evidence for R401's function, similar to the approach used for characterizing mimivirus DNA-associated proteins .

How might R401 contribute to mimivirus-host interactions?

Mimivirus proteins like R401 could play several roles in host interactions:

  • Immune evasion mechanisms:

    • Suppression of host antiviral responses

    • Mimicry of host proteins to avoid detection

    • Interference with host signaling cascades

  • Host resource acquisition:

    • Manipulation of host transcription/translation machinery

    • Alteration of host metabolism to favor viral replication

    • Recruitment of host factors to viral factories

  • Host range determination:

    • Specific interactions with Acanthamoeba cellular components

    • Adaptation to different amoeba species

    • Barriers to cross-species transmission

The study of mimivirus-host interactions has revealed complex relationships involving numerous viral proteins. The successful interaction of mimivirus DNA with Acanthamoeba castellanii in transfection experiments demonstrates the importance of these virus-host interactions .

What contradictions exist in current research about mimivirus uncharacterized proteins, and how might they be resolved?

Several contradictions exist in research on mimivirus uncharacterized proteins:

  • Functional redundancy vs. specificity:

    • Some studies suggest functional redundancy among mimivirus proteins

    • Other evidence indicates highly specific, non-redundant roles for proteins like those in the mimivirus DNA-protein complex

  • Host-dependency contradictions:

    • Variation in experimental outcomes depending on host cell state

    • Differences in protein function between in vitro and in vivo settings

  • Structural prediction discrepancies:

    • Different computational tools can yield contradictory structural models

    • Limited experimental validation of predicted structures

Resolution strategies include:

  • Standardized experimental conditions across laboratories

  • Integration of multiple complementary approaches

  • Direct comparison studies with controlled variables

  • Cross-validation between computational predictions and experimental data

  • Increased collaboration between research groups

For instance, the research on mimivirus DNA transfection demonstrates that controlled experimental design can resolve questions about the necessity of specific proteins for viral function .

How can high-throughput approaches be applied to characterize R401 and similar proteins?

High-throughput approaches offer efficient ways to characterize uncharacterized proteins like R401:

  • Proteome-wide interaction mapping:

    • Protein microarrays to test interactions with host proteome

    • Systematic yeast two-hybrid screens

    • CRISPR screening to identify essential host factors

  • Structural genomics approaches:

    • Parallel expression and purification in multiple systems

    • Automated crystallization condition screening

    • High-throughput NMR for fragment screening

  • Functional genomics:

    • CRISPR-Cas9 screening of viral gene function

    • Pooled mutagenesis with next-generation sequencing readout

    • Transposon mutagenesis for domain mapping

  • Bioinformatic integration:

    • Machine learning to predict protein function from sequence

    • Network analysis to place R401 in functional interaction maps

    • Evolutionary analysis across multiple giant virus species

By applying these technologies systematically, researchers can efficiently characterize proteins like R401 even when starting with minimal information about their function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.