Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein R40 (MIMI_R40)

Shipped with Ice Packs
In Stock

Description

Research Applications and Availability

MIMI_R40 is primarily utilized in experimental settings to study viral protein interactions and immune responses:

Recombinant Protein Production

  • Source: Expressed in E. coli and purified using nickel-chelation chromatography .

  • Storage: Tris-based buffer with 50% glycerol at -20°C .

Diagnostic and Serological Tools

  • ELISA Kits: Recombinant MIMI_R40 is used as an antigen in enzyme-linked immunosorbent assays (ELISAs) to detect anti-APMV antibodies .

Functional Insights and Challenges

While MIMI_R40 remains uncharacterized, its presence in the APMV genome suggests potential roles in viral replication or host interaction. Key observations include:

Comparative Genomic Context

APMV’s genome contains numerous uncharacterized ORFan genes (open reading frames without known homologs), including MIMI_R40. These genes may encode proteins involved in:

  • Viral Genome Packaging: APMV’s genome packaging machinery shares similarities with bacterial systems, including ATPases and recombinases .

  • Host Interaction: Some APMV proteins, such as L136 (a PLP-dependent aminotransferase), are implicated in sugar biosynthesis and fiber formation .

Pathway Involvement

Preliminary pathway analysis suggests MIMI_R40 may participate in undefined viral processes, though no direct functional evidence exists .

Comparative Analysis with Other Mimivirus Proteins

MIMI_R40 shares structural features with other APMV-encoded proteins but lacks functional homology:

ProteinFunctionKey FeaturesReference
L136PLP-dependent aminotransferaseCatalyzes 4-amino-4,6-dideoxy-D-glucose synthesis
R135Putative GMC-type oxidoreductaseRequired for viral DNA replication
MIMI_R40UncharacterizedHis-tagged recombinant protein

Unlike L136 or R135, MIMI_R40 has no confirmed enzymatic activity or role in viral replication.

Future Research Directions

To elucidate MIMI_R40’s function, further studies could:

  1. Investigate Protein Interactions: Use yeast two-hybrid or co-IP assays to identify binding partners.

  2. Knockout Experiments: Assess viral replication efficiency in MIMI_R40-depleted APMV mutants.

  3. Structural Analysis: Solve X-ray crystallography or cryo-EM structures to predict functional motifs.

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order and we will accommodate your needs.
Lead Time
Delivery time may vary depending on the purchase method or location. Please contact your local distributor for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
MIMI_R40; Uncharacterized protein R40
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-101
Protein Length
full length protein
Species
Acanthamoeba polyphaga mimivirus (APMV)
Target Names
MIMI_R40
Target Protein Sequence
MENNNFRDSVLAILVCQFIGPNVFIIIGSIGSVIGVKIMEMYPHYCENHGIYIDKTSVGI AHGIYGIILGFIGIYVFLFVLLFILSIIFSIIYVISKRLSS
Uniprot No.

Target Background

Database Links

KEGG: vg:9924623

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Acanthamoeba polyphaga mimivirus and why is it significant in virology research?

Acanthamoeba polyphaga mimivirus (APMV) is the first discovered giant virus with a remarkably large genome of approximately 1.2 Mb encoding 979 proteins, including components typically associated with cellular organisms such as translation apparatus elements . Its significance lies in challenging the traditional definition of viruses due to its complexity and size. Studying mimivirus provides insights into viral evolution, host-pathogen interactions, and potentially novel biochemical pathways. The virus enters amoeba through phagocytosis, undergoes complex replication involving both nuclear and cytoplasmic phases, and forms distinctive viral factories where assembly occurs .

How does MIMI_R40 fit into the mimivirus proteome classification?

While specific information about MIMI_R40 is limited in current literature, mimivirus proteins are generally classified based on expression timing, localization, and functional prediction. Based on studies of other uncharacterized mimivirus proteins, R40 likely belongs to a category of proteins that may interact with viral DNA, participate in viral assembly, or fulfill yet undetermined regulatory functions. Similar to other mimivirus proteins identified through proteomic studies, R40 might participate in crucial viral processes and potentially show differential expression patterns during the viral replication cycle .

What are the predicted structural features of MIMI_R40?

Without specific structural data on R40, researchers typically rely on computational prediction tools similar to those used for other mimivirus proteins. For instance, when analyzing protein L442, researchers employed the Phyre2 tool to predict tertiary structure and identify potential functional domains . This approach revealed similarity to ATP-dependent DNA helicases, suggesting involvement in DNA metabolism despite relatively low confidence scores (approximately 47-48% confidence) . For R40, similar computational approaches could reveal potential structural motifs, active sites, or homology to proteins with known functions.

What isolation and purification methods are most effective for recombinant MIMI_R40?

For mimivirus protein isolation, researchers typically employ a multi-step approach:

  • Gene cloning into expression vectors (commonly E. coli systems)

  • Optimization of expression conditions (temperature, induction timing, media composition)

  • Cell lysis under conditions preserving protein structure

  • Affinity chromatography (typically His-tag or GST-tag based)

  • Size exclusion chromatography for increased purity

For proteins with DNA-binding potential like several identified mimivirus proteins, maintaining appropriate ionic conditions during purification is critical to preserve functionality. Purification under native conditions rather than denaturing conditions is preferred when analyzing DNA-protein interactions .

How can researchers effectively validate the identity and purity of isolated MIMI_R40?

Validation typically involves multiple complementary techniques:

Validation MethodApplicationDetection LimitAdvantages
SDS-PAGEPurity assessment~100 ng proteinSimple, widely accessible
Western BlotIdentity confirmation~10 ng proteinHigh specificity with appropriate antibodies
MALDI-TOF-MSMass validation~10 pmolHigh accuracy for intact mass
LC-MS/MSSequence confirmation~femtomol rangePeptide-level verification

As demonstrated in mimivirus protein studies, LC-MS/MS provides particularly valuable data for confirmation of protein identity through peptide matching against mimivirus databases . For instance, when analyzing mimivirus DNA-associated proteins, researchers identified L442 through both MALDI-TOF-MS and LC-MS techniques, with the latter providing 11% sequence coverage through identification of 12 peptides .

What specific challenges exist in expressing MIMI_R40 in heterologous systems?

Based on experiences with other mimivirus proteins, researchers may encounter:

  • Codon usage bias when expressing viral genes in bacterial systems

  • Potential toxicity to host cells if the protein interferes with essential cellular processes

  • Incorrect folding due to absence of viral or amoeba-specific chaperones

  • Lack of post-translational modifications present in the native context

  • Solubility issues requiring optimization of buffer conditions

Strategies to overcome these challenges include using codon-optimized constructs, inducible expression systems with tight regulation, fusion with solubility-enhancing tags, and expression at reduced temperatures to promote proper folding .

How can researchers determine if MIMI_R40 interacts with viral DNA or other mimivirus proteins?

Multiple complementary approaches can be employed:

  • Electrophoretic Mobility Shift Assays (EMSA): To detect direct DNA binding, similar to analyses that identified DNA-associated proteins in mimivirus .

  • Chromatin Immunoprecipitation (ChIP): To identify genomic regions bound by R40 in the context of infection.

  • Co-immunoprecipitation: To identify protein interaction partners, as used in mimivirus protein complex studies.

  • Proximity Labeling: Using BioID or APEX2 fusion proteins to identify proximal proteins in the cellular environment.

  • Yeast Two-Hybrid or Bacterial Two-Hybrid Screening: For systematic identification of protein-protein interactions.

The identification of L442, L724, L829, R387, and R135 as DNA-associated proteins in mimivirus demonstrates the value of these approaches in understanding protein function .

What RNA silencing approaches are effective for studying MIMI_R40 function during viral infection?

RNA silencing techniques have been successfully implemented to study mimivirus protein function. Following the methodology used for R458 (translation initiation factor):

  • Design siRNA duplexes targeting specific regions of MIMI_R40 mRNA

  • Transfect amoeba cells using Lipofectamine prior to mimivirus infection

  • Verify silencing efficiency through RT-PCR comparing mRNA levels between wild-type and silenced conditions

  • Monitor effects on viral replication through quantitative PCR at multiple timepoints post-infection

  • Assess impact on viral particle production through endpoint dilution assays

This approach revealed that silencing R458 affected viral growth rate but not final viral particle production, providing insights into its role in translation . Similar approaches could elucidate R40's function by identifying phenotypic consequences of its absence.

How can proteomics approaches help characterize the role of MIMI_R40 in the mimivirus life cycle?

Comparative proteomic analyses between wild-type and R40-silenced mimivirus could reveal downstream effects on viral protein expression. The two-dimensional difference-in-gel electrophoresis (2D-DIGE) approach used to study R458 is particularly informative:

  • Extract proteins from wild-type and MIMI_R40-silenced mimivirus-infected cells

  • Label proteins with different fluorescent dyes

  • Separate proteins on 2D gels based on isoelectric point and molecular weight

  • Identify differentially expressed proteins using MALDI-TOF MS or nano-LC-MS

  • Classify affected proteins into functional categories

This method identified 83 deregulated peptide spots corresponding to 32 different proteins when R458 was silenced, revealing its broader impact on viral processes . Similar analysis for R40 could identify proteins whose expression depends on R40 function, providing clues to its biological role.

How might MIMI_R40 contribute to mimivirus genome organization and replication?

Recent research indicates that the Mimivirus 1.2 Mb genome is elegantly organized into a helical shell structure internally lined by folded DNA strands . If R40 possesses DNA-binding properties similar to other mimivirus proteins like L442, it might contribute to this sophisticated genomic architecture. To investigate this possibility, researchers could:

  • Perform DNA footprinting assays to identify specific binding sites

  • Use cryo-electron microscopy to visualize R40-DNA complexes

  • Employ atomic force microscopy to observe R40's effect on DNA topology

  • Analyze the impact of R40 silencing on genome packaging within virions

  • Conduct time-course analyses to determine when R40 associates with viral DNA during the replication cycle

These approaches could reveal whether R40 participates in the elegant viral genome organization observed in mimivirus .

What role might MIMI_R40 play in host-pathogen interactions during mimivirus infection?

Understanding R40's potential role in host-pathogen interactions requires examining its expression timing and localization during infection:

  • Generate fluorescently tagged R40 to track localization throughout the infection cycle

  • Create amoeba cell lines stably expressing potential host interaction partners to observe co-localization

  • Identify host proteins that co-precipitate with R40 during different infection phases

  • Examine the transcriptional response of host cells to purified R40 protein

  • Compare host protein expression profiles between wild-type and R40-silenced infections

These approaches could reveal whether R40 modulates host defenses, manipulates cellular pathways, or contributes to viral factory formation, similar to roles identified for other mimivirus proteins .

How does structural characterization of MIMI_R40 contribute to understanding its function?

Advanced structural biology techniques provide crucial insights into protein function:

As noted for the L442 protein, "expression in vectors and then diffraction of X-rays by protein crystals could help reveal the exact structure of this protein and its precise role" . Similar approaches for R40 would provide valuable structural insights that inform functional hypotheses.

What evolutionary insights can be gained from comparative analysis of MIMI_R40 across different giant viruses?

Evolutionary analysis of mimivirus proteins has revealed important insights into viral origins and functional conservation. For instance, phylogenetic analysis of the putative GMC-type oxidoreductase R135 and the uncharacterized protein L724 showed that they have homologs in all three lineages of mimiviruses and were likely present in their common ancestor . For R40, researchers could:

  • Conduct BLAST searches to identify homologs in other giant viruses

  • Perform multiple sequence alignments to identify conserved domains

  • Construct phylogenetic trees to understand evolutionary relationships

  • Analyze selection pressure on different regions of the protein

  • Compare genomic context of R40 homologs across viral species

This approach would reveal whether R40 represents a core function conserved across giant viruses or a specialized adaptation of APMV.

What are the optimal conditions for transfection experiments with MIMI_R40?

Successful transfection of amoeba with mimivirus components requires careful optimization:

  • Transfection reagent selection: Lipofectamine has been successfully used for siRNA delivery to Acanthamoeba during mimivirus infection

  • Timing of transfection: For gene silencing studies, transfection immediately before or at early stages of infection (0-3h) proves most effective

  • DNA/RNA concentration: Typically 50-100 ng of nucleic acid per 10^5 amoeba cells

  • Cell density: Using amoeba at approximately 80% confluency

  • Verification method: Microscopic observation of fluorescently labeled transfection components at 3-6 hours confirms successful transfection

When transfecting mimivirus DNA, researchers found that 12 successful experiments out of 50 microinjection sessions could be achieved when proper conditions were maintained .

How can researchers effectively design gene silencing experiments to study MIMI_R40 function?

Effective gene silencing for mimivirus proteins requires:

  • siRNA design:

    • Target unique regions of the R40 sequence

    • Avoid sequences with homology to host genes

    • Design 2-3 different siRNAs targeting different regions

    • Include appropriate controls (scrambled siRNA, unrelated viral gene siRNA)

  • Validation of silencing:

    • RT-PCR to quantify mRNA levels at 6h post-infection

    • Western blot to confirm protein reduction if antibodies are available

    • Compare results to proper controls for specificity

  • Phenotypic analysis:

    • Monitor viral replication through qPCR at 0, 8, 16, and 24h post-infection

    • Use endpoint dilution assays to quantify viral particle production

    • Employ comparative proteomics to identify downstream effects

This approach successfully demonstrated that while R458 silencing decreased viral growth rate, it did not affect final viral particle production , providing insights that could be applied to R40 functional studies.

What are the key knowledge gaps regarding MIMI_R40 that researchers should prioritize?

Current understanding of mimivirus proteins suggests several critical questions for R40 research:

  • Does R40 associate with viral DNA, similar to proteins L442, L724, L829, and R387 ?

  • At what stage of the viral replication cycle is R40 expressed, and does this correlate with specific viral processes?

  • Does R40 function independently or as part of a protein complex?

  • What structural features enable R40's function, and are these conserved across different giant viruses?

  • How does silencing R40 affect the expression of other viral proteins?

Addressing these questions would significantly advance understanding of R40's role in mimivirus biology.

How can insights from MIMI_R40 research contribute to broader understanding of giant virus biology?

Research on mimivirus proteins like R40 contributes to fundamental questions in virology:

  • The evolution of complex viral systems and their relationship to cellular life

  • Mechanisms of viral genome organization and expression

  • Host-pathogen interactions in the context of amoeba and giant viruses

  • Development of the viral factory, a unique feature of giant virus replication

  • Understanding the functional significance of the many uncharacterized proteins in giant virus genomes

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.