Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein R468 (MIMI_R468)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized Protein R468 (MIMI_R468)

The Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized Protein R468, referred to as MIMI_R468, is a protein derived from the Acanthamoeba polyphaga mimivirus (APMV), a giant virus known for its complex genome and diverse protein composition. MIMI_R468 is expressed in Escherichia coli (E. coli) and is tagged with a His-tag for easy purification and identification. This protein is part of the extensive proteome of APMV, which includes over 900 proteins, many of which remain uncharacterized in terms of their specific functions .

Characteristics of MIMI_R468

  • Protein Length and Expression: MIMI_R468 is a full-length protein consisting of 240 amino acids. It is expressed in E. coli, which is a common host for recombinant protein production due to its efficiency and cost-effectiveness .

  • Tagging: The protein is fused with an N-terminal His-tag, facilitating its purification using affinity chromatography techniques .

  • Species Origin: The protein originates from Acanthamoeba polyphaga mimivirus, a virus known for infecting amoebas and possessing a large genome that encodes numerous proteins .

Pathways and Functions

MIMI_R468 is involved in several biochemical pathways, although its specific roles within these pathways are not fully understood. It interacts with other proteins and molecules, which can be identified through techniques like yeast two-hybrid assays, co-immunoprecipitation, and pull-down assays . Understanding these interactions is crucial for elucidating the protein's functions and its potential applications in research.

Data Presentation

To effectively communicate research findings related to MIMI_R468, data should be presented in a clear and concise manner, often using tables and figures to highlight key results. Tables are particularly useful for displaying numerical data, while figures can illustrate trends and relationships between variables .

Example Table: Characteristics of MIMI_R468

CharacteristicDescription
Protein Length240 amino acids
Expression HostE. coli
TagN-terminal His-tag
Species OriginAcanthamoeba polyphaga mimivirus

Example Figure: Expression and Purification of MIMI_R468

A figure could illustrate the process of expressing MIMI_R468 in E. coli and its subsequent purification using affinity chromatography. This would visually represent the steps involved in obtaining the recombinant protein.

Future Research Directions

Future studies on MIMI_R468 could focus on elucidating its specific biochemical functions and its interactions with other proteins within the APMV proteome. Techniques such as RNA interference or protein silencing could be employed to assess the protein's role in viral replication and host-virus interactions . Additionally, structural analysis through X-ray crystallography could provide insights into the protein's structure and potential binding sites, further informing its functional characterization.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
MIMI_R468; Uncharacterized protein R468
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-240
Protein Length
full length protein
Species
Acanthamoeba polyphaga mimivirus (APMV)
Target Names
MIMI_R468
Target Protein Sequence
MEDLVCVSNHNICIHISVNILFIDIYITILMSKQESDNVFWIYDPMILFRDGNYLKIFPT KDMTQIQVLNALTRLCIYLAIIFVLVSAISGYAYVPIIFILIIIVIYFFNNNKNSVQTEM FDDNYPNTNNSDNIDNTDNIMNKQNYKKISDYNPYMNLTLNDIGSGNDDLEANLVELPKD SNRKFYTTSSTTNPNKQEDFMKWIYDLPETCKENQACCLRHEDVRFKRHNPDIDSPTPNS
Uniprot No.

Target Background

Subcellular Location
Membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.