Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein R495 (MIMI_R495)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for fulfillment according to your requirements.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
MIMI_R495; Uncharacterized protein R495
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-140
Protein Length
full length protein
Species
Acanthamoeba polyphaga mimivirus (APMV)
Target Names
MIMI_R495
Target Protein Sequence
MSCITTNNVKRLIILIIFVVIIWQFYYYASSKHNNNFLNEKIAIVPHDIKCLFNQPNCSE ADVDGWSLVQAFIYFVVGLIIPNKYLIIIIVSIILEILKPFIGYEPKYIIGPLLNTTGYI VGSMLSPCKNNYKEKYQIFE
Uniprot No.

Target Background

Database Links

KEGG: vg:9925125

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is MIMI_R495 and what are its basic structural characteristics?

MIMI_R495 is an uncharacterized protein from Acanthamoeba polyphaga mimivirus (APMV). The full-length protein consists of 140 amino acids and can be recombinantly produced with a His-tag using E. coli expression systems . As an uncharacterized protein, its tertiary structure, specific functional domains, and activity mechanisms remain largely unknown. Researchers typically approach such proteins by comparing sequence homology with known proteins, performing in silico structural predictions, and conducting experimental characterization studies to elucidate their properties.

Where does MIMI_R495 fit within the mimivirus proteome?

MIMI_R495 is one of many proteins encoded by the Acanthamoeba polyphaga mimivirus genome. Mimiviruses are notable for containing numerous proteins and RNAs within their virions, many of which may be involved in early stages of infection . While specific information about MIMI_R495's role is limited in the available literature, it belongs to the category of proteins designated with "R" followed by a number, indicating it's encoded on the rightward strand of the viral genome. The specific functions of many mimivirus proteins remain to be fully characterized, making research on proteins like MIMI_R495 important for understanding the complete viral lifecycle.

How does MIMI_R495 compare to other uncharacterized mimivirus proteins?

When comparing MIMI_R495 to other uncharacterized mimivirus proteins, researchers should examine several key features. The full-length recombinant MIMI_R495 protein consists of 140 amino acids and is available as a His-tagged construct expressed in E. coli . In contrast, other uncharacterized mimivirus proteins identified in research include L442 (139,334 Da), L724 (24,033 Da), L829 (49,226 Da), and R387 (30,067 Da) . These proteins have been identified through techniques such as MALDI-TOF-MS and LC-MS analysis. Unlike some of these proteins that have demonstrated roles in viral DNA functionality (such as L442, which appears necessary for viral production after DNA microinjection), the specific function of MIMI_R495 requires further investigation to determine whether it plays similar critical roles in the viral lifecycle.

What expression systems are most effective for recombinant production of MIMI_R495?

For recombinant production of MIMI_R495, E. coli expression systems have proven effective, as demonstrated by the available His-tagged recombinant protein . When establishing an expression protocol, researchers should consider:

  • Expression vector selection: Vectors containing strong inducible promoters (like T7) and appropriate selection markers

  • E. coli strain optimization: BL21(DE3) or its derivatives are commonly used for protein expression

  • Induction conditions: Optimizing IPTG concentration, temperature, and induction time

  • Solubility enhancement: Using solubility tags (His-tag is already implemented) or optimizing buffer conditions

  • Purification strategy: Implementing affinity chromatography using the His-tag, followed by size exclusion chromatography

The existing recombinant MIMI_R495 is produced as a full-length (1-140 amino acids) His-tagged protein, suggesting that E. coli can properly express this viral protein without significant toxicity or inclusion body formation issues that might require alternative expression systems.

What analytical techniques are most appropriate for characterizing the structure and function of an uncharacterized protein like MIMI_R495?

For comprehensive characterization of an uncharacterized protein like MIMI_R495, multiple complementary analytical techniques should be employed:

Structural Analysis Techniques:

  • Circular Dichroism (CD): To assess secondary structure content (α-helices, β-sheets)

  • X-ray Crystallography: For high-resolution 3D structure determination (similar to approaches suggested for proteins like L442)

  • Nuclear Magnetic Resonance (NMR): For solution structure and dynamics analysis

  • Mass Spectrometry: For accurate molecular weight determination and post-translational modifications identification

Functional Analysis Techniques:

  • Protein-Protein Interaction Assays: Co-immunoprecipitation, yeast two-hybrid, or pull-down assays to identify interaction partners

  • Enzymatic Activity Assays: Based on predicted functions from bioinformatic analysis

  • Viral Transfection Experiments: Similar to those performed for other mimivirus proteins, to determine if MIMI_R495 is essential for viral infectivity

  • Proteinase K Sensitivity Tests: To assess if MIMI_R495 remains associated with viral DNA after extraction and its importance in viral function

The choice of techniques should be guided by preliminary bioinformatic analyses to generate hypotheses about potential functions of MIMI_R495.

How can researchers effectively design experiments to determine if MIMI_R495 is associated with viral DNA?

Based on research methods used for other mimivirus proteins, researchers can design experiments to determine if MIMI_R495 is associated with viral DNA using the following approach:

  • DNA Extraction and Protein Analysis:

    • Extract viral DNA using standard methods (e.g., using EZ1 DNA Tissue Kit)

    • Analyze protein content by SDS-PAGE before and after proteinase K treatment

    • Perform western blot using anti-MIMI_R495 antibodies to detect its presence

  • DNA-Protein Interaction Analysis:

    • Conduct chromatin immunoprecipitation (ChIP) assays using MIMI_R495-specific antibodies

    • Perform electrophoretic mobility shift assays (EMSA) with purified MIMI_R495 and viral DNA fragments

    • Use DNA-protein cross-linking followed by mass spectrometry analysis

  • Functional Transfection Experiments:

    • Prepare viral DNA with and without proteinase K treatment (to remove DNA-associated proteins)

    • Transfect DNA preparations into host amoeba using microinjection techniques

    • Compare viral production efficiency between treatments

    • Use immunofluorescence to track MIMI_R495 during early infection stages

This experimental design is based on methods that successfully identified other DNA-associated proteins in mimivirus (such as L442, L724, L829, and R387) , which could serve as positive controls in these experiments.

What controls should be included when studying MIMI_R495 function in mimivirus infection cycles?

When designing experiments to study MIMI_R495 function in mimivirus infection cycles, the following controls should be included:

Positive Controls:

  • Known DNA-associated mimivirus proteins (L442, L724, L829, R387) to validate experimental procedures

  • Wild-type mimivirus infection to establish baseline infection parameters

  • GMC-type oxidoreductase R135 if enzymatic activity is being assessed

Negative Controls:

  • Mock-infected amoeba cultures

  • Non-microinjected amoeba with DNA and fluorescent dye added to the medium (for transfection experiments)

  • Irrelevant proteins of similar size/structure to control for non-specific effects

  • Host cells treated with inhibitors of viral replication

Technical Controls:

  • Proteinase K-treated viral DNA to remove all associated proteins

  • DNase-treated samples to distinguish DNA from protein bands in gel analysis

  • Fluorescent dye (e.g., rhodamine-dextran) to confirm successful microinjection

  • Time-course sampling to capture the complete infection cycle

These controls will help distinguish specific MIMI_R495 functions from general viral processes and technical artifacts, providing reliable data interpretation.

How can knockout or knockdown approaches be adapted to study the function of MIMI_R495 in mimivirus?

Studying mimivirus proteins through knockout or knockdown approaches presents unique challenges due to the viral nature of the target. Here's a comprehensive strategy:

CRISPR-Cas9 Approach:

  • Design guide RNAs targeting the MIMI_R495 gene in the viral genome

  • Transfect purified mimivirus DNA and CRISPR-Cas9 components into amoeba

  • Screen for viral clones with disrupted MIMI_R495 using PCR and sequencing

  • Characterize phenotypic effects on viral replication, morphology, and infectivity

Antisense/RNA Interference Approach:

  • Design antisense oligonucleotides or siRNAs targeting MIMI_R495 transcripts

  • Transfect into amoeba prior to viral infection

  • Monitor viral gene expression, protein production, and infection progression

  • Quantify viral titers to assess replication efficiency

Dominant Negative Mutant Approach:

  • Create truncated or mutated versions of MIMI_R495

  • Express these constructs in amoeba before viral infection

  • Assess competition with wild-type protein and functional interference

Complementation Studies:

  • In successful knockout lines, reintroduce wild-type or mutant versions of MIMI_R495

  • Evaluate rescue of phenotype to confirm specificity of effects

  • Use controlled expression systems to titrate protein levels

These approaches should be complemented with protein localization studies and interaction analyses to build a comprehensive understanding of MIMI_R495 function in the viral lifecycle.

What are the key considerations when designing assays to identify potential interaction partners of MIMI_R495?

Identifying interaction partners is crucial for understanding the function of uncharacterized proteins like MIMI_R495. Here are key considerations for designing effective interaction assays:

Sample Preparation Considerations:

  • Expression System Selection: Use systems that maintain natural conformation and post-translational modifications

  • Tagging Strategy: Consider both N- and C-terminal tags to avoid interference with interaction domains

  • Buffer Optimization: Test various conditions to maintain protein stability and native interactions

  • Cross-linking Parameters: If using cross-linking approaches, optimize reagent concentration and reaction time

Methodology Selection:

  • Pull-down Assays: Use purified His-tagged MIMI_R495 as bait with viral or host cell lysates

  • Co-immunoprecipitation: Develop specific antibodies against MIMI_R495 or use tag-specific antibodies

  • Proximity Labeling: Consider BioID or APEX2 fusion proteins to identify transient interactions

  • Yeast Two-Hybrid: For binary interaction screening, particularly with a library of other viral proteins

Validation Strategies:

  • Reciprocal Pull-downs: Confirm interactions by pulling down with the identified partner

  • Competitive Binding: Use excess untagged protein to demonstrate specificity

  • Domain Mapping: Create truncated constructs to identify interaction interfaces

  • Functional Assays: Test if disrupting interactions affects viral replication or protein function

Data Analysis Considerations:

  • False Positive Filtering: Compare against control datasets to remove common contaminants

  • Network Analysis: Place identified interactions in the context of known viral protein networks

  • Interaction Dynamics: Consider temporal aspects of interactions during the viral lifecycle

These approaches should help build a comprehensive interactome map for MIMI_R495, providing insights into its potential functions.

How should researchers approach the analysis of contradictory data when studying uncharacterized proteins like MIMI_R495?

When encountering contradictory data in research on uncharacterized proteins like MIMI_R495, a structured analytical approach is essential:

Systematic Data Contradiction Analysis Framework:

  • Categorization of Contradictions:

    • Apply the (α, β, θ) notation system to classify the nature of contradictions, where α represents the number of interdependent items, β represents the number of contradictory dependencies, and θ represents the minimal number of required Boolean rules to assess these contradictions

    • For example, if studying MIMI_R495 yields contradictory results across three experimental conditions (α=3), with two incompatible observations (β=2), determine the minimum logical rules needed to resolve this contradiction (θ)

  • Methodological Reconciliation:

    • Examine experimental variables (temperature, pH, salt concentration, host cell state)

    • Consider protein preparation differences (tags, purification methods, storage conditions)

    • Evaluate temporal factors in viral lifecycle studies

  • Technical Validation:

    • Implement alternative detection methods to confirm observations

    • Vary experimental conditions systematically to identify parameter-dependent effects

    • Increase biological and technical replicates to strengthen statistical power

  • Biological Interpretation:

    • Consider potential dual functions of MIMI_R495 under different conditions

    • Evaluate host-specific factors that might influence protein behavior

    • Assess if contradictions reflect natural biological variability rather than experimental error

  • Integration with Existing Knowledge:

    • Compare with patterns observed in other mimivirus proteins (especially L442, L724, L829, and R387)

    • Apply Boolean minimization techniques to reduce complex contradictory datasets to minimal logical rules

This structured approach transforms apparent contradictions from obstacles into valuable indicators of complex biological behaviors, potentially revealing important insights about MIMI_R495's multifunctional nature.

What bioinformatic approaches are most valuable for predicting the function of MIMI_R495?

A comprehensive bioinformatic strategy for predicting MIMI_R495 function should incorporate multiple complementary approaches:

Sequence-Based Analysis:

  • Homology Searches: Using PSI-BLAST, HHpred, and HMMER against diverse databases

  • Motif Detection: Employing PROSITE, PRINTS, and BLOCKS to identify functional motifs

  • Domain Prediction: Utilizing SMART, Pfam, and InterPro to identify conserved domains

  • Phylogenetic Analysis: Constructing trees with related viral proteins to infer evolutionary relationships

  • Conservation Mapping: Identifying highly conserved residues across related viruses

Structure-Based Prediction:

  • Secondary Structure Prediction: Using PSIPRED, JPred, and GOR methods

  • Tertiary Structure Modeling: Applying AlphaFold2, I-TASSER, or Phyre2 (as used for other mimivirus proteins)

  • Binding Site Prediction: Using CASTp, POCKET, or SiteMap to identify potential functional sites

  • Molecular Dynamics Simulations: To assess structural stability and potential conformational changes

  • Protein-Protein Docking: With potential interaction partners identified in experimental studies

Functional Inference:

  • Gene Neighborhood Analysis: Examining genomic context of MIMI_R495 in the mimivirus genome

  • Co-expression Patterns: Analyzing temporal expression during viral infection

  • Protein-Protein Interaction Networks: Integrating with known mimivirus protein interactions

  • Text Mining: Using natural language processing to extract relevant information from literature

  • Gene Ontology Mapping: Predicting function based on similarities to proteins with known GO terms

Integration and Validation:

  • Consensus Approach: Combining predictions from multiple methods to increase confidence

  • Confidence Scoring: Assigning reliability scores to different predictions

  • Experimental Design: Using predictions to guide targeted experimental validation

This multi-layered approach maximizes the chance of generating reliable functional hypotheses for MIMI_R495 that can be experimentally tested.

How can researchers distinguish between direct and indirect effects when assessing MIMI_R495's role in viral processes?

Distinguishing between direct and indirect effects of MIMI_R495 requires a multi-faceted experimental approach:

Temporal Analysis:

  • High-resolution Time Course: Monitor viral processes with frequent sampling to establish causality

  • Synchronized Infection: Use techniques to synchronize infection across cell populations

  • Pulse-chase Experiments: Track protein dynamics during specific phases of viral lifecycle

Spatial Analysis:

  • Subcellular Localization: Use fluorescence microscopy to track MIMI_R495 localization during infection

  • Co-localization Studies: Determine if MIMI_R495 co-localizes with viral DNA or other viral components

  • Fractionation Experiments: Isolate subcellular compartments to determine protein distribution

Interaction Analysis:

  • Direct Binding Assays: Use purified components to demonstrate direct physical interactions

  • Competition Experiments: Show displacement of binding with increasing concentrations

  • Domain Mapping: Identify specific interaction interfaces through mutation or truncation

Functional Dissection:

  • Rescue Experiments: Test if purified MIMI_R495 can complement defects in knockdown/knockout systems

  • Reconstitution Assays: Rebuild minimal systems with defined components to demonstrate sufficiency

  • Dose-response Relationships: Establish quantitative relationships between MIMI_R495 levels and outcomes

Specific Controls:

  • Paralogue Comparisons: Test related mimivirus proteins to assess specificity

  • Inactive Mutants: Engineer catalytically inactive versions to separate binding from function

  • Temporal Inhibitors: Use reversible inhibitors to block function at specific timepoints

By integrating these approaches, researchers can build a comprehensive understanding of whether MIMI_R495 directly participates in viral processes or indirectly influences them through intermediate factors.

What are the most promising approaches for determining if MIMI_R495 interacts with host cell proteins during infection?

To comprehensively investigate MIMI_R495 interactions with host cell proteins, researchers should implement these advanced approaches:

In Situ Proximity Labeling:

  • BioID/TurboID Fusion: Express MIMI_R495 fused to biotin ligase in host cells

  • APEX2 Proximity Labeling: Create MIMI_R495-APEX2 fusions for peroxidase-based labeling

  • Spatio-temporal Resolution: Apply conditional activation systems to capture interactions at specific infection stages

  • In-infection Labeling: Introduce labeled MIMI_R495 during active infection to capture native interactions

Advanced Mass Spectrometry Approaches:

  • Crosslinking Mass Spectrometry (XL-MS): Use chemical crosslinkers to stabilize transient interactions

  • Hydrogen-Deuterium Exchange MS: Map interaction interfaces through differential solvent accessibility

  • Native MS: Analyze intact complexes to preserve weak or transient interactions

  • SILAC/TMT Labeling: Quantitatively compare interactome changes during infection progression

Fluorescence-Based Methods:

  • Förster Resonance Energy Transfer (FRET): Detect direct protein-protein interactions in living cells

  • Fluorescence Correlation Spectroscopy: Analyze binding dynamics and residence times

  • Fluorescence Recovery After Photobleaching: Assess mobility and binding kinetics in viral factories

  • Single-Molecule Tracking: Follow individual MIMI_R495 molecules during infection

Functional Validation:

  • Host Protein Depletion: Use siRNA/CRISPR to knock down candidate interactors

  • Interaction-Blocking Peptides: Design peptides that specifically disrupt predicted interfaces

  • Domain Swapping: Create chimeric proteins to map interaction specificity determinants

  • Host Range Correlation: Compare interactions across permissive and non-permissive host species

These approaches should be combined with bioinformatic predictions of host-virus protein interaction networks to generate and test specific hypotheses about MIMI_R495's role at the host-pathogen interface.

What advanced techniques could be employed to determine the three-dimensional structure of MIMI_R495?

For elucidating the three-dimensional structure of MIMI_R495, researchers should consider these cutting-edge structural biology approaches:

X-ray Crystallography Optimization:

  • Surface Entropy Reduction: Mutate surface residues with high conformational entropy to aid crystallization

  • Fusion Partner Screening: Test multiple fusion proteins (T4 lysozyme, BRIL, etc.) to facilitate crystal contacts

  • Crystallization Chaperones: Use antibody fragments or nanobodies to stabilize flexible regions

  • Microseeding Techniques: Employ matrix microseeding to optimize crystal growth conditions

  • In situ Diffraction: Utilize in situ plate scanning at synchrotron beamlines to detect microcrystals

Cryo-Electron Microscopy:

  • Single Particle Analysis: For high-resolution structure determination of MIMI_R495 alone or in complexes

  • Graphene Oxide Support: Use ultrathin supports to improve particle distribution and orientation

  • Time-Resolved Cryo-EM: Capture different conformational states using microfluidic mixing devices

  • Focused Classification: Deal with conformational heterogeneity through computational sorting

Nuclear Magnetic Resonance Advances:

  • Non-Uniform Sampling: Reduce acquisition time for multidimensional spectra

  • Selective Isotope Labeling: Implement amino acid-specific labeling to resolve crowded spectra

  • Paramagnetic Tags: Introduce paramagnetic centers to obtain long-range distance constraints

  • TROSY Techniques: Optimize pulse sequences for the 140-amino acid MIMI_R495 size range

Integrative Structural Biology:

Expression Optimization for Structural Studies:

  • Construct Optimization: Create truncation constructs based on disorder predictions

  • Isotope Labeling: Establish efficient protocols for 13C, 15N, and 2H labeling in E. coli

  • Refolding Strategies: Develop protocols to recover properly folded protein from inclusion bodies if necessary

These approaches should be pursued in parallel to maximize the chances of success in determining the structure of this challenging viral protein.

How might researchers investigate the evolutionary significance of MIMI_R495 within the context of giant virus biology?

Investigating the evolutionary significance of MIMI_R495 requires a comprehensive approach that integrates multiple perspectives:

Comparative Genomic Analysis:

  • Ortholog Identification: Search for MIMI_R495 homologs across all sequenced giant viruses

  • Synteny Analysis: Examine conservation of genomic context around MIMI_R495 orthologs

  • Gene Family Expansion/Contraction: Investigate potential duplications or losses in different viral lineages

  • Selection Analysis: Calculate dN/dS ratios to identify signatures of purifying or positive selection

  • Recombination Detection: Analyze potential horizontal gene transfer events

Structural Evolution:

  • Structural Homology Detection: Use structure prediction tools to identify distant homologs undetectable by sequence

  • Domain Architecture Analysis: Compare domain organization across viral lineages

  • Fold Comparisons: Determine if MIMI_R495 represents a novel fold or adapts existing structural motifs

  • Structural Constraint Mapping: Identify evolutionarily constrained regions that maintain structural integrity

Functional Evolution:

  • Ancestral Sequence Reconstruction: Infer and synthesize ancestral versions of MIMI_R495

  • Functional Assays of Orthologs: Compare biochemical properties across diverse viral species

  • Host Range Correlation: Analyze if MIMI_R495 variants correlate with host specificity

  • Experimental Evolution: Monitor changes in MIMI_R495 sequence during serial passage in different hosts

Phylogenetic Approaches:

  • Gene Tree-Species Tree Reconciliation: Identify discordances suggesting horizontal gene transfer

  • Bayesian Relaxed Clock Models: Date the emergence of MIMI_R495 in viral lineages

  • Phylogenetic Profiling: Correlate presence/absence patterns with viral lifestyle characteristics

  • Co-evolution Analysis: Identify potential interaction partners that co-evolve with MIMI_R495

Virus-Host Interface Evolution:

  • Arms Race Signatures: Look for rapid evolution at putative host-interaction sites

  • Host Mimicry: Assess if MIMI_R495 shares features with host proteins (molecular mimicry)

  • Experimental Host Range: Test if MIMI_R495 variants affect viral host range or tropism

These approaches would provide a comprehensive evolutionary context for MIMI_R495, potentially revealing its origins, functional importance, and role in the remarkable biology of giant viruses.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.