MIMI_R513 is a 168-amino acid protein encoded by the Acanthamoeba polyphaga mimivirus (APMV) genome (UniProt ID: Q5UQ82) . It is classified as an "uncharacterized protein" due to limited functional studies but shares genomic context with other mimivirus proteins involved in oxidative pathways, transcription, and membrane interactions . Recombinant versions are expressed in E. coli with a His tag for purification .
Tertiary Structure: Computational modeling (e.g., Phyre2) suggests potential α-helical domains, though experimental validation is pending .
Post-Translational Modifications: Glycosylation sites predicted via GlyCosmos .
Putative Roles: APMV proteins with "uncharacterized" labels, such as L442 and R387, have been implicated in viral replication and DNA-protein interactions . While direct evidence for MIMI_R513 is lacking, its genomic proximity to oxidative enzymes (e.g., GMC-type oxidoreductases) suggests involvement in redox pathways .
DNA Association: Protease-treated APMV DNA extracts lose infectivity, highlighting the importance of DNA-bound proteins like MIMI_R513 in replication .
Antigen Production: Recombinant MIMI_R513 is used in ELISA kits for antibody generation (e.g., Creative BioMart Cat# CSB-CF729335ADAZ) .
Host Interactions: APMV can infect human phagocytic cells in vitro, raising interest in MIMI_R513’s potential immune modulation .
Functional Studies: No in vivo or in vitro activity assays have been published for MIMI_R513.
Pathway Associations: Predicted involvement in oxidative pathways requires validation via knock-out experiments .
Structural Biology: Cryo-EM or crystallography studies are needed to resolve its 3D architecture .
KEGG: vg:9925144
MIMI_R513 is an uncharacterized protein encoded by the Acanthamoeba polyphaga mimivirus (APMV) genome. The full-length protein consists of 168 amino acids and has the UniProt ID Q5UQ82 . Based on sequence analysis, MIMI_R513 likely contains transmembrane regions suggesting it may be a membrane-associated protein. This characteristic is supported by the presence of hydrophobic stretches in its amino acid sequence.
The key properties of MIMI_R513 are summarized in the following table:
| Property | Description |
|---|---|
| Organism | Acanthamoeba polyphaga mimivirus (APMV) |
| UniProt ID | Q5UQ82 |
| Gene Name | MIMI_R513 |
| Protein Length | 168 amino acids (full length) |
| Amino Acid Sequence | MSDVTVTPSATSKLTGILKPGSYEIEKGHFSRYFSLNWWQLIVVVGIAISGIAAIANTYDAITGVDKDIEGCENVSNLRKKLEAKFIIIIVLSCLAVVGGIILAWLLRSGTNQRKLLTMGLTTGGILGILYALTIRFRGTSNMVKLGISWVSLLAFVLLGFFINTSGE |
| Form | Lyophilized powder (recombinant) |
| Source | E. coli (for recombinant expression) |
| Tag | His (N-terminal) |
| Purity | >90% by SDS-PAGE |
The recombinant expression and purification of MIMI_R513 requires a systematic methodological approach:
Expression Protocol:
Clone the MIMI_R513 gene (encoding amino acids 1-168) into a bacterial expression vector with an N-terminal His-tag .
Transform the construct into E. coli expression strains (BL21(DE3) is commonly used).
Grow transformed bacteria in LB medium with appropriate antibiotics at 37°C until OD600 reaches 0.6-0.8.
Induce protein expression with IPTG (0.5-1.0 mM) and continue culture at reduced temperature (16-25°C) for 4-18 hours.
Harvest cells by centrifugation at 5,000 × g for 15 minutes at 4°C.
Purification Protocol:
Resuspend bacterial pellet in lysis buffer containing protease inhibitors.
Lyse cells using sonication or high-pressure homogenization.
Clarify lysate by centrifugation at 15,000-20,000 × g for 30 minutes at 4°C.
Load supernatant onto Ni-NTA affinity column pre-equilibrated with binding buffer.
Wash column with binding buffer containing low imidazole (20-40 mM) to remove non-specifically bound proteins.
Elute His-tagged MIMI_R513 with elution buffer containing high imidazole (250-500 mM) .
Analyze purity by SDS-PAGE (should be >90% pure).
Perform buffer exchange to remove imidazole using dialysis or gel filtration.
Concentrate protein using centrifugal filter devices if necessary.
Lyophilize in Tris/PBS-based buffer with 6% Trehalose, pH 8.0 for long-term storage .
Proper storage and handling of recombinant MIMI_R513 are critical for maintaining its stability and functionality:
Storage Recommendations:
For long-term storage, aliquot the protein to avoid repeated freeze-thaw cycles .
The storage buffer typically consists of Tris/PBS-based buffer with 6% Trehalose at pH 8.0 .
Reconstitution Protocol:
Briefly centrifuge the vial prior to opening to bring contents to the bottom .
Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL .
For long-term storage of reconstituted protein, add glycerol to a final concentration of 5-50% .
The recommended final concentration of glycerol is 50% for optimal stability .
Aliquot the reconstituted protein to avoid repeated freeze-thaw cycles.
Quality Control Measures:
Verify protein integrity by SDS-PAGE after reconstitution if concerns about stability arise.
Monitor for signs of protein aggregation or precipitation before experimental use.
If possible, confirm activity using functional assays appropriate for the research context.
RNA interference (RNAi) provides a powerful approach for investigating the function of viral proteins including MIMI_R513. The following detailed methodology can be implemented based on successful studies of other mimivirus proteins :
siRNA Design and Preparation:
Design 2-3 siRNAs targeting different regions of the MIMI_R513 gene.
Use siRNA design tools to identify sequences with optimal properties (19-25 nucleotides with 2-nucleotide 3' overhangs).
Perform BLAST search against the mimivirus genome to ensure target specificity.
Include appropriate control siRNAs (non-targeting siRNA and siRNA targeting a known structural protein like L425) .
Transfection and Infection Protocol:
Culture Acanthamoeba polyphaga cells in appropriate growth medium at 28°C.
Prepare cells at 5 × 10^5 cells/mL in fresh medium for transfection.
Mix siRNA (final concentration 50-100 nM) with a lipid-based transfection reagent.
Add the transfection mixture to amoeba cells and incubate for 24-48 hours.
Infect transfected amoebae with Acanthamoeba polyphaga mimivirus at a multiplicity of infection (MOI) of 5-10 .
Allow viral replication to proceed for 8-16 hours.
Analysis of Knockdown Effects:
Harvest virus particles from culture supernatant.
Purify virions using filtration and gradient ultracentrifugation.
Analyze viral morphology by electron microscopy, focusing on potential structural alterations .
Confirm MIMI_R513 knockdown by Western blotting using specific antibodies.
Assess impact on viral replication by viral titer determination.
Compare results with control samples (untreated virions and virions treated with control siRNAs) .
This methodological approach has been successfully applied to study other mimivirus proteins including R135, L725, L829, and R856, which were identified as being associated with viral fiber formation .
Negative Controls:
Untreated mimivirus virions to establish baseline characteristics .
Treatment with non-targeting siRNAs to control for non-specific effects of the transfection process .
siRNA targeting the L425 gene (encoding major capsid protein) as a control for proteins not associated with fibers .
Mock-transfected host cells to control for effects of transfection reagents.
Positive Controls:
siRNAs targeting known functional proteins (e.g., R135, L725, L829, or R856) with established phenotypes .
Isolated fiber proteins as references for biochemical and structural studies.
Characterized deletion mutants such as the M4 strain (lacking fibers and missing 150 genes) .
Validation Controls:
Multiple siRNAs targeting different regions of MIMI_R513 to confirm specificity of observed phenotypes.
Rescue experiments by expressing siRNA-resistant MIMI_R513 to verify that observed effects are specific to MIMI_R513 knockdown.
Dose-response tests with varying concentrations of siRNA to establish relationship between knockdown efficiency and phenotypic effects.
Development of specific antibodies against MIMI_R513 requires a systematic approach similar to that used for other mimivirus proteins :
Antigen Preparation:
Express full-length MIMI_R513 or immunogenic fragments in E. coli with appropriate fusion tags (His, GST, or thioredoxin) to improve solubility and purification .
Purify the recombinant protein using affinity chromatography followed by size exclusion chromatography to ensure high purity.
Verify protein identity by mass spectrometry and assess purity by SDS-PAGE.
Immunization Strategy:
Immunize mice or rabbits with purified MIMI_R513 protein following standard immunization protocols .
For polyclonal antibodies, collect serum after sufficient immune response (typically 10-12 weeks).
For monoclonal antibodies, harvest spleen cells and perform fusion with myeloma cells to generate hybridomas.
Screen hybridoma supernatants for antibody production by ELISA against the immunizing antigen.
Antibody Validation:
Assess specificity by Western blotting against:
Purified recombinant MIMI_R513
Total protein extract from mimivirus-infected amoebae
Uninfected amoeba lysate (negative control)
Perform immunoprecipitation to confirm ability to recognize native protein.
Conduct immunofluorescence or immunoelectron microscopy to determine subcellular localization of MIMI_R513 in infected cells .
Test cross-reactivity with related viral proteins to ensure specificity.
Validate antibody performance in additional applications (e.g., ELISA, flow cytometry) as needed.
This validation process ensures that the antibodies are specific, sensitive, and suitable for the intended research applications, similar to the approach used for antibodies against L725 protein .
The structural characterization of MIMI_R513 requires a multi-faceted approach, particularly given its predicted membrane association:
X-ray Crystallography Protocol:
Optimize expression and purification to achieve protein concentration >10 mg/mL with >95% purity.
Screen hundreds of crystallization conditions using commercial screens (e.g., Hampton Research, Molecular Dimensions).
Optimize promising conditions by varying precipitant concentration, pH, temperature, and additives.
Harvest crystals and cryoprotect for data collection at synchrotron radiation sources.
Process diffraction data using software packages such as XDS or HKL2000.
Solve phase problem using molecular replacement or experimental phasing methods.
Build and refine atomic model using programs like Coot and PHENIX.
Cryo-Electron Microscopy Approach (Recommended for Membrane Proteins):
Prepare protein sample at 0.5-5 mg/mL in buffer with minimal salt content.
Apply sample to glow-discharged EM grids and vitrify by plunge-freezing in liquid ethane.
Collect images using direct electron detector at high magnification.
Process data using single particle analysis software (RELION, cryoSPARC).
Generate 3D reconstructions at progressively higher resolutions.
Build atomic model into the density map using molecular dynamics flexible fitting.
Validate structure using independent datasets and complementary techniques.
Integrative Structural Biology Strategy:
Obtain low-resolution information using small-angle X-ray scattering (SAXS).
Generate computational models using AlphaFold2 or RoseTTAFold.
Validate model predictions using targeted experiments:
Site-directed mutagenesis of predicted functional sites
Crosslinking mass spectrometry to identify spatial relationships
Hydrogen-deuterium exchange to map solvent-accessible regions
Integrate all data sources to develop a comprehensive structural model.
This methodological framework provides multiple approaches to overcome the challenges associated with structural determination of membrane-associated viral proteins like MIMI_R513.
The identification and characterization of post-translational modifications (PTMs) in MIMI_R513 requires specialized methodological approaches:
Mass Spectrometry-Based Proteomic Analysis:
Sample preparation:
Digest purified MIMI_R513 with multiple proteases (trypsin, chymotrypsin, GluC) to ensure comprehensive coverage.
Perform parallel digestions of protein isolated from recombinant sources and from infected cells.
Enrichment of modified peptides:
Phosphopeptides: Immobilized metal affinity chromatography (IMAC) or titanium dioxide (TiO2) enrichment
Glycopeptides: Hydrazide chemistry, lectin affinity, or HILIC enrichment
Ubiquitinated peptides: Antibody enrichment against diGly remnants
LC-MS/MS analysis:
Use high-resolution mass spectrometry (Q-Exactive, Orbitrap Fusion)
Apply multiple fragmentation techniques (HCD, ETD, EThcD) for improved PTM localization
Data analysis:
Search against mimivirus protein database with variable modifications
Apply strict false discovery rate controls (typically 1% FDR)
Use site localization algorithms (e.g., Ascore, ptmRS) to assign confidence to modification sites
Glycan Analysis Protocol:
Site-specific glycan profiling:
Treat protein with PNGase F to release N-linked glycans or chemical β-elimination for O-linked glycans
Label released glycans with fluorescent tag (2-AB, 2-AA, or procainamide)
Analyze by HILIC-UPLC with fluorescence detection
Glycan structure determination:
Perform sequential exoglycosidase digestions to determine linkage information
Analyze by MALDI-TOF MS and MS/MS for detailed structural information
Compare against reference standards for glycan identification
This is particularly relevant given that mimivirus fibers are known to be highly glycosylated, antigenic, and resistant to protease and collagenase treatment .
To elucidate MIMI_R513's potential role in mimivirus fiber structure and assembly, the following methodological approaches can be implemented:
Localization Studies:
Immunogold electron microscopy protocol:
Fix purified virions or infected cells with glutaraldehyde/paraformaldehyde
Embed in resin and prepare ultrathin sections
Incubate with anti-MIMI_R513 antibodies followed by gold-conjugated secondary antibodies
Image using transmission electron microscope at high magnification
Perform quantitative analysis of gold particle distribution relative to fiber structures
Correlative light and electron microscopy (CLEM):
Generate fluorescently tagged MIMI_R513 constructs
Track localization during viral assembly in living cells
Process samples for electron microscopy
Correlate fluorescence signal with ultrastructural features
Protein-Protein Interaction Analysis:
Co-immunoprecipitation method:
Crosslinking mass spectrometry:
Apply chemical crosslinkers (BS3, DSS, EDC) to intact virions
Digest crosslinked samples and enrich for crosslinked peptides
Identify crosslinked peptides by LC-MS/MS
Map interaction interfaces using specialized software (xQuest, Kojak)
Comparative Analysis with Fiber-Deficient Strains:
Proteomics comparison method:
Isolate and purify virions from wild-type mimivirus and the fiber-deficient M4 strain
Perform quantitative proteomics using label-free or isotope labeling approaches
Analyze differential protein expression patterns
Determine whether MIMI_R513 is depleted in the M4 strain similar to R135, L829, and R856 proteins
Functional complementation:
Develop a system for genetic manipulation of mimivirus
Generate recombinant virus lacking MIMI_R513
Assess impact on fiber structure using electron microscopy
Complement with wild-type MIMI_R513 to restore phenotype
These methodological approaches provide a comprehensive framework for investigating MIMI_R513's potential role in mimivirus fiber structure, similar to methods used to characterize other fiber-associated proteins .
To explore MIMI_R513's potential involvement in host-pathogen interactions, the following detailed methodological approaches can be implemented:
Host Protein Interaction Screening:
Yeast two-hybrid screening protocol:
Clone MIMI_R513 coding sequence into bait vector
Screen against cDNA library from Acanthamoeba polyphaga
Select positive interactions based on reporter gene activation
Sequence and identify interacting host proteins
Validate interactions using independent methods (co-IP, FRET)
Proximity labeling approach:
Generate fusion constructs of MIMI_R513 with BioID or TurboID
Express in host cells and allow biotinylation of proximal proteins
Affinity purify biotinylated proteins using streptavidin
Identify by mass spectrometry and compare to controls
Host Cell Pathway Analysis:
Transcriptomics protocol:
Express MIMI_R513 in host cells or compare infection with wild-type vs. MIMI_R513-deficient virus
Extract total RNA and prepare libraries for RNA-seq
Sequence using high-throughput platform
Analyze differential gene expression
Perform pathway enrichment analysis to identify affected cellular processes
Phosphoproteomics approach:
Prepare cellular extracts from control and MIMI_R513-expressing cells
Enrich phosphopeptides using IMAC or TiO2
Analyze by LC-MS/MS
Identify differentially phosphorylated proteins
Map to signaling pathways using bioinformatic tools
Trafficking and Localization Analysis:
Live-cell imaging protocol:
Generate fluorescently tagged MIMI_R513 constructs
Express in host cells and image using confocal microscopy
Track protein localization during different stages of infection
Co-localize with markers for cellular compartments
Analyze dynamics using photobleaching techniques (FRAP, FLIP)
Subcellular fractionation:
Separate cellular compartments using differential centrifugation
Analyze distribution of MIMI_R513 across fractions by Western blotting
Compare with markers for different organelles
Assess changes in localization during infection progression
These methodologies provide a comprehensive approach to investigating MIMI_R513's potential role in host-pathogen interactions, which could reveal important insights into mimivirus infection mechanisms.
To investigate the evolutionary aspects of MIMI_R513, researchers can employ the following systematic methodological approaches:
Sequence Conservation Analysis:
Database searching protocol:
Perform BLASTP searches against viral, bacterial, and eukaryotic databases
Use position-specific iterative BLAST (PSI-BLAST) for detecting remote homologs
Apply profile hidden Markov models using HMMER for increased sensitivity
Search for conserved domains using InterProScan or CDD
Multiple sequence alignment method:
Align MIMI_R513 with identified homologs using MUSCLE, MAFFT, or T-Coffee
Refine alignments manually to correct for potential errors
Calculate sequence identity and similarity scores
Generate sequence logos to visualize conservation patterns
Conservation scoring protocol:
Use programs like ConSurf to calculate position-specific conservation scores
Map conservation onto predicted structural models
Identify highly conserved motifs that may indicate functional importance
Correlate conservation with predicted structural elements
Phylogenetic Analysis:
Tree construction protocol:
Select appropriate evolutionary model using ModelTest or similar tools
Generate maximum likelihood trees using RAxML or IQ-TREE
Perform Bayesian inference using MrBayes or BEAST
Assess node support with bootstrap or posterior probability values
Tree analysis method:
Root tree using appropriate outgroups
Identify major clades and evolutionary relationships
Estimate divergence times if molecular clock assumptions are valid
Infer potential horizontal gene transfer events
Structural Conservation Analysis:
Structure prediction protocol:
Generate structural models of MIMI_R513 using AlphaFold2 or RoseTTAFold
Predict structures for homologs identified in sequence searches
Compare predicted structures using structural alignment tools (DALI, TM-align)
Calculate root-mean-square deviation (RMSD) between aligned structures
Structure-based alignment method:
Align sequences based on structural superposition
Identify structurally conserved regions that may not be apparent in sequence alignments
Predict functional sites based on structural conservation
Generate structure-guided multiple sequence alignments
This comprehensive evolutionary analysis approach can provide insights into MIMI_R513's functional importance, potential horizontal transfer events, and evolutionary origins, which may help illuminate its role in mimivirus biology.
To predict potential functions of this uncharacterized protein, researchers can implement the following detailed bioinformatic methodologies:
Sequence-Based Functional Prediction:
Motif and domain analysis protocol:
Scan MIMI_R513 sequence against domain databases (Pfam, SMART, ProDom)
Identify short functional motifs using ELM, PROSITE, or ScanProsite
Search for transmembrane domains using TMHMM, Phobius, or TOPCONS
Predict signal peptides using SignalP
Functional site prediction method:
Identify potential active sites using tools like CLIPS or ConSurf
Predict ligand-binding sites using 3DLigandSite or COACH
Analyze for post-translational modification sites using NetPhos, NetOGlyc, or NetNGlyc
Search for protein sorting signals using cellular localization prediction tools
Structural Bioinformatics Approach:
Integrated structure prediction protocol:
Generate 3D structure models using AlphaFold2
Validate models using MolProbity or PROCHECK
Compare with structural databases using DALI or VAST
Identify structurally similar proteins with known functions
Molecular docking method:
Predict potential binding partners using protein-protein docking (HADDOCK, ClusPro)
Perform small molecule docking to identify potential ligands
Analyze predicted binding interfaces for conservation and physicochemical properties
Validate predictions with molecular dynamics simulations
Genomic Context Analysis:
Gene neighborhood analysis protocol:
Examine adjacent genes in the mimivirus genome
Look for operonic structures or gene clusters with related functions
Analyze conservation of gene neighborhood across related viruses
Identify potential functional associations based on genomic context
Co-expression pattern analysis:
Analyze transcriptomic data across infection time course
Identify genes with similar expression patterns to MIMI_R513
Perform cluster analysis to group co-expressed genes
Infer potential functional relationships based on co-expression
The information obtained from these bioinformatic approaches can guide experimental design by generating testable hypotheses about MIMI_R513's function, potentially revealing its role in viral structure, replication, or host interaction.
Developing MIMI_R513 as a research tool requires specialized methodological approaches:
Protein Engineering Strategies:
Epitope tagging protocol:
Identify regions of MIMI_R513 tolerant to modification based on structural predictions
Insert common epitope tags (FLAG, HA, c-Myc) at N- or C-terminus or internal permissive sites
Express and purify tagged variants
Validate tag accessibility using commercial antibodies
Assess impact of tagging on protein function and localization
Fluorescent protein fusion method:
Generate fusions with fluorescent proteins (GFP, mCherry, mScarlet)
Optimize linker length and composition to maintain protein function
Express in viral context or heterologous systems
Validate proper folding and fluorescence properties
Use for real-time imaging of protein dynamics
Application Development:
Diagnostic tool development protocol:
Assess MIMI_R513 conservation across mimivirus strains
Develop ELISA or lateral flow assays using recombinant MIMI_R513 and specific antibodies
Optimize assay parameters (antibody concentrations, buffer conditions, detection methods)
Validate using characterized mimivirus samples
Determine specificity and sensitivity metrics
Viral tracking method:
Label MIMI_R513 in intact virions using site-specific fluorescent labeling techniques
Optimize labeling conditions to maintain viral infectivity
Track viral entry and trafficking in host cells using confocal microscopy
Correlate with infection progression and viral replication
These methodological approaches can transform MIMI_R513 from an uncharacterized protein into a valuable research tool for studying mimivirus biology and host-pathogen interactions.
To comprehensively investigate the structure-function relationship of MIMI_R513, researchers should implement the following experimental designs:
Structure-Guided Mutagenesis Approach:
Alanine scanning mutagenesis protocol:
Generate a library of MIMI_R513 mutants with systematic alanine substitutions
Express and purify mutant proteins
Assess structural integrity using circular dichroism or thermal shift assays
Evaluate functional impact using appropriate assays
Map functionally important residues onto structural model
Domain deletion/swapping method:
Identify discrete domains or structural elements based on computational predictions
Generate constructs with specific domains deleted or replaced
Express and characterize the resulting chimeric proteins
Determine which domains are critical for specific functions
Design minimal functional constructs for specialized applications
Structure-Function Correlation Analysis:
Comprehensive phenotypic analysis protocol:
Generate mimivirus variants expressing mutated MIMI_R513
Characterize viral morphology using electron microscopy
Assess impact on viral replication kinetics
Evaluate effects on host cell interaction
Correlate phenotypic changes with specific structural features
In vitro functional reconstitution method:
Identify potential binding partners through interaction studies
Purify MIMI_R513 and identified partners
Reconstitute functional complexes in vitro
Characterize using biophysical techniques (ITC, SPR, MST)
Analyze structural basis of interactions using crosslinking MS or cryo-EM
Computational-Experimental Integration:
Molecular dynamics simulation protocol:
Generate atomic models of MIMI_R513 in relevant environments (membrane, aqueous)
Perform extensive MD simulations (>100 ns) using GROMACS or NAMD
Analyze conformational dynamics and identify stable states
Predict functional sites based on dynamics
Validate predictions experimentally using site-directed mutagenesis
Integrative structural biology approach:
Combine experimental data from multiple sources (XL-MS, HDX-MS, SAXS, NMR)
Integrate with computational predictions
Generate composite structural models
Identify key structural determinants of function
Design targeted experiments to test structure-function hypotheses
This comprehensive approach integrates structural analysis with functional characterization to elucidate the molecular mechanisms underlying MIMI_R513's role in mimivirus biology.