Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein R513 (MIMI_R513)

Shipped with Ice Packs
In Stock

Description

Protein Overview

MIMI_R513 is a 168-amino acid protein encoded by the Acanthamoeba polyphaga mimivirus (APMV) genome (UniProt ID: Q5UQ82) . It is classified as an "uncharacterized protein" due to limited functional studies but shares genomic context with other mimivirus proteins involved in oxidative pathways, transcription, and membrane interactions . Recombinant versions are expressed in E. coli with a His tag for purification .

Predicted Features

  • Tertiary Structure: Computational modeling (e.g., Phyre2) suggests potential α-helical domains, though experimental validation is pending .

  • Post-Translational Modifications: Glycosylation sites predicted via GlyCosmos .

Functional Insights

  • Putative Roles: APMV proteins with "uncharacterized" labels, such as L442 and R387, have been implicated in viral replication and DNA-protein interactions . While direct evidence for MIMI_R513 is lacking, its genomic proximity to oxidative enzymes (e.g., GMC-type oxidoreductases) suggests involvement in redox pathways .

  • DNA Association: Protease-treated APMV DNA extracts lose infectivity, highlighting the importance of DNA-bound proteins like MIMI_R513 in replication .

Experimental Applications

  • Antigen Production: Recombinant MIMI_R513 is used in ELISA kits for antibody generation (e.g., Creative BioMart Cat# CSB-CF729335ADAZ) .

  • Host Interactions: APMV can infect human phagocytic cells in vitro, raising interest in MIMI_R513’s potential immune modulation .

Knowledge Gaps and Future Directions

  • Functional Studies: No in vivo or in vitro activity assays have been published for MIMI_R513.

  • Pathway Associations: Predicted involvement in oxidative pathways requires validation via knock-out experiments .

  • Structural Biology: Cryo-EM or crystallography studies are needed to resolve its 3D architecture .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific format requirements, please indicate them in your order. We will prepare according to your specifications.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type preference, please inform us. We will prioritize developing the specified tag if possible.
Synonyms
MIMI_R513; Uncharacterized protein R513
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-168
Protein Length
full length protein
Species
Acanthamoeba polyphaga mimivirus (APMV)
Target Names
MIMI_R513
Target Protein Sequence
MSDVTVTPSATSKLTGILKPGSYEIEKGHFSRYFSLNWWQLIVVVGIAISGIAAIANTYD AITGVDKDIEGCENVSNLRKKLEAKFIIIIVLSCLAVVGGIILAWLLRSGTNQRKLLTMG LTTGGILGILYALTIRFRGTSNMVKLGISWVSLLAFVLLGFFINTSGE
Uniprot No.

Target Background

Database Links

KEGG: vg:9925144

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is MIMI_R513 and what are its fundamental properties?

MIMI_R513 is an uncharacterized protein encoded by the Acanthamoeba polyphaga mimivirus (APMV) genome. The full-length protein consists of 168 amino acids and has the UniProt ID Q5UQ82 . Based on sequence analysis, MIMI_R513 likely contains transmembrane regions suggesting it may be a membrane-associated protein. This characteristic is supported by the presence of hydrophobic stretches in its amino acid sequence.

The key properties of MIMI_R513 are summarized in the following table:

PropertyDescription
OrganismAcanthamoeba polyphaga mimivirus (APMV)
UniProt IDQ5UQ82
Gene NameMIMI_R513
Protein Length168 amino acids (full length)
Amino Acid SequenceMSDVTVTPSATSKLTGILKPGSYEIEKGHFSRYFSLNWWQLIVVVGIAISGIAAIANTYDAITGVDKDIEGCENVSNLRKKLEAKFIIIIVLSCLAVVGGIILAWLLRSGTNQRKLLTMGLTTGGILGILYALTIRFRGTSNMVKLGISWVSLLAFVLLGFFINTSGE
FormLyophilized powder (recombinant)
SourceE. coli (for recombinant expression)
TagHis (N-terminal)
Purity>90% by SDS-PAGE

What protocols should be followed for recombinant expression and purification of MIMI_R513?

The recombinant expression and purification of MIMI_R513 requires a systematic methodological approach:

Expression Protocol:

  • Clone the MIMI_R513 gene (encoding amino acids 1-168) into a bacterial expression vector with an N-terminal His-tag .

  • Transform the construct into E. coli expression strains (BL21(DE3) is commonly used).

  • Grow transformed bacteria in LB medium with appropriate antibiotics at 37°C until OD600 reaches 0.6-0.8.

  • Induce protein expression with IPTG (0.5-1.0 mM) and continue culture at reduced temperature (16-25°C) for 4-18 hours.

  • Harvest cells by centrifugation at 5,000 × g for 15 minutes at 4°C.

Purification Protocol:

  • Resuspend bacterial pellet in lysis buffer containing protease inhibitors.

  • Lyse cells using sonication or high-pressure homogenization.

  • Clarify lysate by centrifugation at 15,000-20,000 × g for 30 minutes at 4°C.

  • Load supernatant onto Ni-NTA affinity column pre-equilibrated with binding buffer.

  • Wash column with binding buffer containing low imidazole (20-40 mM) to remove non-specifically bound proteins.

  • Elute His-tagged MIMI_R513 with elution buffer containing high imidazole (250-500 mM) .

  • Analyze purity by SDS-PAGE (should be >90% pure).

  • Perform buffer exchange to remove imidazole using dialysis or gel filtration.

  • Concentrate protein using centrifugal filter devices if necessary.

  • Lyophilize in Tris/PBS-based buffer with 6% Trehalose, pH 8.0 for long-term storage .

What storage and handling procedures ensure optimal stability of recombinant MIMI_R513?

Proper storage and handling of recombinant MIMI_R513 are critical for maintaining its stability and functionality:

Storage Recommendations:

  • Store lyophilized protein at -20°C/-80°C upon receipt .

  • For long-term storage, aliquot the protein to avoid repeated freeze-thaw cycles .

  • Working aliquots can be stored at 4°C for up to one week .

  • The storage buffer typically consists of Tris/PBS-based buffer with 6% Trehalose at pH 8.0 .

Reconstitution Protocol:

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom .

  • Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL .

  • For long-term storage of reconstituted protein, add glycerol to a final concentration of 5-50% .

  • The recommended final concentration of glycerol is 50% for optimal stability .

  • Aliquot the reconstituted protein to avoid repeated freeze-thaw cycles.

  • Store aliquots at -20°C/-80°C for long-term stability .

Quality Control Measures:

  • Verify protein integrity by SDS-PAGE after reconstitution if concerns about stability arise.

  • Monitor for signs of protein aggregation or precipitation before experimental use.

  • If possible, confirm activity using functional assays appropriate for the research context.

How can RNA interference be applied to study MIMI_R513 function?

RNA interference (RNAi) provides a powerful approach for investigating the function of viral proteins including MIMI_R513. The following detailed methodology can be implemented based on successful studies of other mimivirus proteins :

siRNA Design and Preparation:

  • Design 2-3 siRNAs targeting different regions of the MIMI_R513 gene.

  • Use siRNA design tools to identify sequences with optimal properties (19-25 nucleotides with 2-nucleotide 3' overhangs).

  • Perform BLAST search against the mimivirus genome to ensure target specificity.

  • Include appropriate control siRNAs (non-targeting siRNA and siRNA targeting a known structural protein like L425) .

Transfection and Infection Protocol:

  • Culture Acanthamoeba polyphaga cells in appropriate growth medium at 28°C.

  • Prepare cells at 5 × 10^5 cells/mL in fresh medium for transfection.

  • Mix siRNA (final concentration 50-100 nM) with a lipid-based transfection reagent.

  • Add the transfection mixture to amoeba cells and incubate for 24-48 hours.

  • Infect transfected amoebae with Acanthamoeba polyphaga mimivirus at a multiplicity of infection (MOI) of 5-10 .

  • Allow viral replication to proceed for 8-16 hours.

Analysis of Knockdown Effects:

  • Harvest virus particles from culture supernatant.

  • Purify virions using filtration and gradient ultracentrifugation.

  • Analyze viral morphology by electron microscopy, focusing on potential structural alterations .

  • Confirm MIMI_R513 knockdown by Western blotting using specific antibodies.

  • Assess impact on viral replication by viral titer determination.

  • Compare results with control samples (untreated virions and virions treated with control siRNAs) .

This methodological approach has been successfully applied to study other mimivirus proteins including R135, L725, L829, and R856, which were identified as being associated with viral fiber formation .

What experimental controls are essential when studying MIMI_R513?

Negative Controls:

  • Untreated mimivirus virions to establish baseline characteristics .

  • Treatment with non-targeting siRNAs to control for non-specific effects of the transfection process .

  • siRNA targeting the L425 gene (encoding major capsid protein) as a control for proteins not associated with fibers .

  • Mock-transfected host cells to control for effects of transfection reagents.

Positive Controls:

  • siRNAs targeting known functional proteins (e.g., R135, L725, L829, or R856) with established phenotypes .

  • Isolated fiber proteins as references for biochemical and structural studies.

  • Characterized deletion mutants such as the M4 strain (lacking fibers and missing 150 genes) .

Validation Controls:

  • Multiple siRNAs targeting different regions of MIMI_R513 to confirm specificity of observed phenotypes.

  • Rescue experiments by expressing siRNA-resistant MIMI_R513 to verify that observed effects are specific to MIMI_R513 knockdown.

  • Dose-response tests with varying concentrations of siRNA to establish relationship between knockdown efficiency and phenotypic effects.

How should antibodies against MIMI_R513 be developed and validated?

Development of specific antibodies against MIMI_R513 requires a systematic approach similar to that used for other mimivirus proteins :

Antigen Preparation:

  • Express full-length MIMI_R513 or immunogenic fragments in E. coli with appropriate fusion tags (His, GST, or thioredoxin) to improve solubility and purification .

  • Purify the recombinant protein using affinity chromatography followed by size exclusion chromatography to ensure high purity.

  • Verify protein identity by mass spectrometry and assess purity by SDS-PAGE.

Immunization Strategy:

  • Immunize mice or rabbits with purified MIMI_R513 protein following standard immunization protocols .

  • For polyclonal antibodies, collect serum after sufficient immune response (typically 10-12 weeks).

  • For monoclonal antibodies, harvest spleen cells and perform fusion with myeloma cells to generate hybridomas.

  • Screen hybridoma supernatants for antibody production by ELISA against the immunizing antigen.

Antibody Validation:

  • Assess specificity by Western blotting against:

    • Purified recombinant MIMI_R513

    • Total protein extract from mimivirus-infected amoebae

    • Uninfected amoeba lysate (negative control)

  • Perform immunoprecipitation to confirm ability to recognize native protein.

  • Conduct immunofluorescence or immunoelectron microscopy to determine subcellular localization of MIMI_R513 in infected cells .

  • Test cross-reactivity with related viral proteins to ensure specificity.

  • Validate antibody performance in additional applications (e.g., ELISA, flow cytometry) as needed.

This validation process ensures that the antibodies are specific, sensitive, and suitable for the intended research applications, similar to the approach used for antibodies against L725 protein .

What techniques should be employed to determine the structure of MIMI_R513?

The structural characterization of MIMI_R513 requires a multi-faceted approach, particularly given its predicted membrane association:

X-ray Crystallography Protocol:

  • Optimize expression and purification to achieve protein concentration >10 mg/mL with >95% purity.

  • Screen hundreds of crystallization conditions using commercial screens (e.g., Hampton Research, Molecular Dimensions).

  • Optimize promising conditions by varying precipitant concentration, pH, temperature, and additives.

  • Harvest crystals and cryoprotect for data collection at synchrotron radiation sources.

  • Process diffraction data using software packages such as XDS or HKL2000.

  • Solve phase problem using molecular replacement or experimental phasing methods.

  • Build and refine atomic model using programs like Coot and PHENIX.

Cryo-Electron Microscopy Approach (Recommended for Membrane Proteins):

  • Prepare protein sample at 0.5-5 mg/mL in buffer with minimal salt content.

  • Apply sample to glow-discharged EM grids and vitrify by plunge-freezing in liquid ethane.

  • Collect images using direct electron detector at high magnification.

  • Process data using single particle analysis software (RELION, cryoSPARC).

  • Generate 3D reconstructions at progressively higher resolutions.

  • Build atomic model into the density map using molecular dynamics flexible fitting.

  • Validate structure using independent datasets and complementary techniques.

Integrative Structural Biology Strategy:

  • Obtain low-resolution information using small-angle X-ray scattering (SAXS).

  • Generate computational models using AlphaFold2 or RoseTTAFold.

  • Validate model predictions using targeted experiments:

    • Site-directed mutagenesis of predicted functional sites

    • Crosslinking mass spectrometry to identify spatial relationships

    • Hydrogen-deuterium exchange to map solvent-accessible regions

  • Integrate all data sources to develop a comprehensive structural model.

This methodological framework provides multiple approaches to overcome the challenges associated with structural determination of membrane-associated viral proteins like MIMI_R513.

How can potential post-translational modifications of MIMI_R513 be identified and characterized?

The identification and characterization of post-translational modifications (PTMs) in MIMI_R513 requires specialized methodological approaches:

Mass Spectrometry-Based Proteomic Analysis:

  • Sample preparation:

    • Digest purified MIMI_R513 with multiple proteases (trypsin, chymotrypsin, GluC) to ensure comprehensive coverage.

    • Perform parallel digestions of protein isolated from recombinant sources and from infected cells.

  • Enrichment of modified peptides:

    • Phosphopeptides: Immobilized metal affinity chromatography (IMAC) or titanium dioxide (TiO2) enrichment

    • Glycopeptides: Hydrazide chemistry, lectin affinity, or HILIC enrichment

    • Ubiquitinated peptides: Antibody enrichment against diGly remnants

  • LC-MS/MS analysis:

    • Use high-resolution mass spectrometry (Q-Exactive, Orbitrap Fusion)

    • Apply multiple fragmentation techniques (HCD, ETD, EThcD) for improved PTM localization

  • Data analysis:

    • Search against mimivirus protein database with variable modifications

    • Apply strict false discovery rate controls (typically 1% FDR)

    • Use site localization algorithms (e.g., Ascore, ptmRS) to assign confidence to modification sites

Glycan Analysis Protocol:

  • Site-specific glycan profiling:

    • Treat protein with PNGase F to release N-linked glycans or chemical β-elimination for O-linked glycans

    • Label released glycans with fluorescent tag (2-AB, 2-AA, or procainamide)

    • Analyze by HILIC-UPLC with fluorescence detection

  • Glycan structure determination:

    • Perform sequential exoglycosidase digestions to determine linkage information

    • Analyze by MALDI-TOF MS and MS/MS for detailed structural information

    • Compare against reference standards for glycan identification

This is particularly relevant given that mimivirus fibers are known to be highly glycosylated, antigenic, and resistant to protease and collagenase treatment .

How can the potential role of MIMI_R513 in mimivirus fiber structure be investigated?

To elucidate MIMI_R513's potential role in mimivirus fiber structure and assembly, the following methodological approaches can be implemented:

Localization Studies:

  • Immunogold electron microscopy protocol:

    • Fix purified virions or infected cells with glutaraldehyde/paraformaldehyde

    • Embed in resin and prepare ultrathin sections

    • Incubate with anti-MIMI_R513 antibodies followed by gold-conjugated secondary antibodies

    • Image using transmission electron microscope at high magnification

    • Perform quantitative analysis of gold particle distribution relative to fiber structures

  • Correlative light and electron microscopy (CLEM):

    • Generate fluorescently tagged MIMI_R513 constructs

    • Track localization during viral assembly in living cells

    • Process samples for electron microscopy

    • Correlate fluorescence signal with ultrastructural features

Protein-Protein Interaction Analysis:

  • Co-immunoprecipitation method:

    • Prepare lysates from infected cells or purified virions

    • Perform immunoprecipitation using anti-MIMI_R513 antibodies

    • Analyze co-precipitated proteins by mass spectrometry

    • Compare with immunoprecipitation using antibodies against known fiber components (R135, L725, L829)

  • Crosslinking mass spectrometry:

    • Apply chemical crosslinkers (BS3, DSS, EDC) to intact virions

    • Digest crosslinked samples and enrich for crosslinked peptides

    • Identify crosslinked peptides by LC-MS/MS

    • Map interaction interfaces using specialized software (xQuest, Kojak)

Comparative Analysis with Fiber-Deficient Strains:

  • Proteomics comparison method:

    • Isolate and purify virions from wild-type mimivirus and the fiber-deficient M4 strain

    • Perform quantitative proteomics using label-free or isotope labeling approaches

    • Analyze differential protein expression patterns

    • Determine whether MIMI_R513 is depleted in the M4 strain similar to R135, L829, and R856 proteins

  • Functional complementation:

    • Develop a system for genetic manipulation of mimivirus

    • Generate recombinant virus lacking MIMI_R513

    • Assess impact on fiber structure using electron microscopy

    • Complement with wild-type MIMI_R513 to restore phenotype

These methodological approaches provide a comprehensive framework for investigating MIMI_R513's potential role in mimivirus fiber structure, similar to methods used to characterize other fiber-associated proteins .

What methodologies can be applied to investigate MIMI_R513's potential role in host-pathogen interactions?

To explore MIMI_R513's potential involvement in host-pathogen interactions, the following detailed methodological approaches can be implemented:

Host Protein Interaction Screening:

  • Yeast two-hybrid screening protocol:

    • Clone MIMI_R513 coding sequence into bait vector

    • Screen against cDNA library from Acanthamoeba polyphaga

    • Select positive interactions based on reporter gene activation

    • Sequence and identify interacting host proteins

    • Validate interactions using independent methods (co-IP, FRET)

  • Proximity labeling approach:

    • Generate fusion constructs of MIMI_R513 with BioID or TurboID

    • Express in host cells and allow biotinylation of proximal proteins

    • Affinity purify biotinylated proteins using streptavidin

    • Identify by mass spectrometry and compare to controls

Host Cell Pathway Analysis:

  • Transcriptomics protocol:

    • Express MIMI_R513 in host cells or compare infection with wild-type vs. MIMI_R513-deficient virus

    • Extract total RNA and prepare libraries for RNA-seq

    • Sequence using high-throughput platform

    • Analyze differential gene expression

    • Perform pathway enrichment analysis to identify affected cellular processes

  • Phosphoproteomics approach:

    • Prepare cellular extracts from control and MIMI_R513-expressing cells

    • Enrich phosphopeptides using IMAC or TiO2

    • Analyze by LC-MS/MS

    • Identify differentially phosphorylated proteins

    • Map to signaling pathways using bioinformatic tools

Trafficking and Localization Analysis:

  • Live-cell imaging protocol:

    • Generate fluorescently tagged MIMI_R513 constructs

    • Express in host cells and image using confocal microscopy

    • Track protein localization during different stages of infection

    • Co-localize with markers for cellular compartments

    • Analyze dynamics using photobleaching techniques (FRAP, FLIP)

  • Subcellular fractionation:

    • Separate cellular compartments using differential centrifugation

    • Analyze distribution of MIMI_R513 across fractions by Western blotting

    • Compare with markers for different organelles

    • Assess changes in localization during infection progression

These methodologies provide a comprehensive approach to investigating MIMI_R513's potential role in host-pathogen interactions, which could reveal important insights into mimivirus infection mechanisms.

What methods should be used to analyze the evolutionary conservation of MIMI_R513?

To investigate the evolutionary aspects of MIMI_R513, researchers can employ the following systematic methodological approaches:

Sequence Conservation Analysis:

  • Database searching protocol:

    • Perform BLASTP searches against viral, bacterial, and eukaryotic databases

    • Use position-specific iterative BLAST (PSI-BLAST) for detecting remote homologs

    • Apply profile hidden Markov models using HMMER for increased sensitivity

    • Search for conserved domains using InterProScan or CDD

  • Multiple sequence alignment method:

    • Align MIMI_R513 with identified homologs using MUSCLE, MAFFT, or T-Coffee

    • Refine alignments manually to correct for potential errors

    • Calculate sequence identity and similarity scores

    • Generate sequence logos to visualize conservation patterns

  • Conservation scoring protocol:

    • Use programs like ConSurf to calculate position-specific conservation scores

    • Map conservation onto predicted structural models

    • Identify highly conserved motifs that may indicate functional importance

    • Correlate conservation with predicted structural elements

Phylogenetic Analysis:

  • Tree construction protocol:

    • Select appropriate evolutionary model using ModelTest or similar tools

    • Generate maximum likelihood trees using RAxML or IQ-TREE

    • Perform Bayesian inference using MrBayes or BEAST

    • Assess node support with bootstrap or posterior probability values

  • Tree analysis method:

    • Root tree using appropriate outgroups

    • Identify major clades and evolutionary relationships

    • Estimate divergence times if molecular clock assumptions are valid

    • Infer potential horizontal gene transfer events

Structural Conservation Analysis:

  • Structure prediction protocol:

    • Generate structural models of MIMI_R513 using AlphaFold2 or RoseTTAFold

    • Predict structures for homologs identified in sequence searches

    • Compare predicted structures using structural alignment tools (DALI, TM-align)

    • Calculate root-mean-square deviation (RMSD) between aligned structures

  • Structure-based alignment method:

    • Align sequences based on structural superposition

    • Identify structurally conserved regions that may not be apparent in sequence alignments

    • Predict functional sites based on structural conservation

    • Generate structure-guided multiple sequence alignments

This comprehensive evolutionary analysis approach can provide insights into MIMI_R513's functional importance, potential horizontal transfer events, and evolutionary origins, which may help illuminate its role in mimivirus biology.

How can researchers investigate potential functions of MIMI_R513 based on bioinformatic predictions?

To predict potential functions of this uncharacterized protein, researchers can implement the following detailed bioinformatic methodologies:

Sequence-Based Functional Prediction:

  • Motif and domain analysis protocol:

    • Scan MIMI_R513 sequence against domain databases (Pfam, SMART, ProDom)

    • Identify short functional motifs using ELM, PROSITE, or ScanProsite

    • Search for transmembrane domains using TMHMM, Phobius, or TOPCONS

    • Predict signal peptides using SignalP

  • Functional site prediction method:

    • Identify potential active sites using tools like CLIPS or ConSurf

    • Predict ligand-binding sites using 3DLigandSite or COACH

    • Analyze for post-translational modification sites using NetPhos, NetOGlyc, or NetNGlyc

    • Search for protein sorting signals using cellular localization prediction tools

Structural Bioinformatics Approach:

  • Integrated structure prediction protocol:

    • Generate 3D structure models using AlphaFold2

    • Validate models using MolProbity or PROCHECK

    • Compare with structural databases using DALI or VAST

    • Identify structurally similar proteins with known functions

  • Molecular docking method:

    • Predict potential binding partners using protein-protein docking (HADDOCK, ClusPro)

    • Perform small molecule docking to identify potential ligands

    • Analyze predicted binding interfaces for conservation and physicochemical properties

    • Validate predictions with molecular dynamics simulations

Genomic Context Analysis:

  • Gene neighborhood analysis protocol:

    • Examine adjacent genes in the mimivirus genome

    • Look for operonic structures or gene clusters with related functions

    • Analyze conservation of gene neighborhood across related viruses

    • Identify potential functional associations based on genomic context

  • Co-expression pattern analysis:

    • Analyze transcriptomic data across infection time course

    • Identify genes with similar expression patterns to MIMI_R513

    • Perform cluster analysis to group co-expressed genes

    • Infer potential functional relationships based on co-expression

The information obtained from these bioinformatic approaches can guide experimental design by generating testable hypotheses about MIMI_R513's function, potentially revealing its role in viral structure, replication, or host interaction.

What methodological approaches can be used to develop MIMI_R513 as a research tool?

Developing MIMI_R513 as a research tool requires specialized methodological approaches:

Protein Engineering Strategies:

  • Epitope tagging protocol:

    • Identify regions of MIMI_R513 tolerant to modification based on structural predictions

    • Insert common epitope tags (FLAG, HA, c-Myc) at N- or C-terminus or internal permissive sites

    • Express and purify tagged variants

    • Validate tag accessibility using commercial antibodies

    • Assess impact of tagging on protein function and localization

  • Fluorescent protein fusion method:

    • Generate fusions with fluorescent proteins (GFP, mCherry, mScarlet)

    • Optimize linker length and composition to maintain protein function

    • Express in viral context or heterologous systems

    • Validate proper folding and fluorescence properties

    • Use for real-time imaging of protein dynamics

Application Development:

  • Diagnostic tool development protocol:

    • Assess MIMI_R513 conservation across mimivirus strains

    • Develop ELISA or lateral flow assays using recombinant MIMI_R513 and specific antibodies

    • Optimize assay parameters (antibody concentrations, buffer conditions, detection methods)

    • Validate using characterized mimivirus samples

    • Determine specificity and sensitivity metrics

  • Viral tracking method:

    • Label MIMI_R513 in intact virions using site-specific fluorescent labeling techniques

    • Optimize labeling conditions to maintain viral infectivity

    • Track viral entry and trafficking in host cells using confocal microscopy

    • Correlate with infection progression and viral replication

These methodological approaches can transform MIMI_R513 from an uncharacterized protein into a valuable research tool for studying mimivirus biology and host-pathogen interactions.

What experimental designs would best address the structure-function relationship of MIMI_R513?

To comprehensively investigate the structure-function relationship of MIMI_R513, researchers should implement the following experimental designs:

Structure-Guided Mutagenesis Approach:

  • Alanine scanning mutagenesis protocol:

    • Generate a library of MIMI_R513 mutants with systematic alanine substitutions

    • Express and purify mutant proteins

    • Assess structural integrity using circular dichroism or thermal shift assays

    • Evaluate functional impact using appropriate assays

    • Map functionally important residues onto structural model

  • Domain deletion/swapping method:

    • Identify discrete domains or structural elements based on computational predictions

    • Generate constructs with specific domains deleted or replaced

    • Express and characterize the resulting chimeric proteins

    • Determine which domains are critical for specific functions

    • Design minimal functional constructs for specialized applications

Structure-Function Correlation Analysis:

  • Comprehensive phenotypic analysis protocol:

    • Generate mimivirus variants expressing mutated MIMI_R513

    • Characterize viral morphology using electron microscopy

    • Assess impact on viral replication kinetics

    • Evaluate effects on host cell interaction

    • Correlate phenotypic changes with specific structural features

  • In vitro functional reconstitution method:

    • Identify potential binding partners through interaction studies

    • Purify MIMI_R513 and identified partners

    • Reconstitute functional complexes in vitro

    • Characterize using biophysical techniques (ITC, SPR, MST)

    • Analyze structural basis of interactions using crosslinking MS or cryo-EM

Computational-Experimental Integration:

  • Molecular dynamics simulation protocol:

    • Generate atomic models of MIMI_R513 in relevant environments (membrane, aqueous)

    • Perform extensive MD simulations (>100 ns) using GROMACS or NAMD

    • Analyze conformational dynamics and identify stable states

    • Predict functional sites based on dynamics

    • Validate predictions experimentally using site-directed mutagenesis

  • Integrative structural biology approach:

    • Combine experimental data from multiple sources (XL-MS, HDX-MS, SAXS, NMR)

    • Integrate with computational predictions

    • Generate composite structural models

    • Identify key structural determinants of function

    • Design targeted experiments to test structure-function hypotheses

This comprehensive approach integrates structural analysis with functional characterization to elucidate the molecular mechanisms underlying MIMI_R513's role in mimivirus biology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.