Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein R557 (MIMI_R557)

Shipped with Ice Packs
In Stock

Description

General Information

MIMI_R557 is an uncharacterized protein encoded by the Acanthamoeba polyphaga mimivirus . Due to the limited research on MIMI_R557, specific details regarding its structure, function, and interactions are not yet well-defined. Further studies are required to elucidate its role within the mimivirus life cycle and its potential impact on host-virus interactions.

Genomic Context

The genome of APMV is approximately 1.2 Mb and encodes for close to 1,000 proteins . These proteins include components of the translation apparatus . The presence of these genes suggests a level of autonomy in viral replication and host interaction. The location of the MIMI_R557 gene within the APMV genome and its proximity to other genes may provide insights into its regulation and function.

Protein Characteristics

As an uncharacterized protein, the precise biochemical and biophysical properties of MIMI_R557 are currently unknown. Based on its amino acid sequence, computational analyses may predict potential structural motifs, domains, and post-translational modification sites. These predictions can guide experimental studies to determine its actual structure and function.

Potential Functions

  • Structural Component: MIMI_R557 could be a structural component of the virion . Proteomic analyses of purified virions may identify MIMI_R557 as a constituent protein.

  • Enzymatic Activity: Sequence analysis might reveal potential catalytic domains, suggesting enzymatic activity . Biochemical assays could then be employed to test these predictions.

  • Regulatory Role: MIMI_R557 may play a role in regulating viral gene expression or host-virus interactions . Investigating its interactions with other viral or host proteins may uncover such regulatory functions.

Intrinsically Disordered Proteins (IDPs)

Intrinsically disordered proteins (IDPs) lack a fixed or ordered three-dimensional structure . IDPs often contain flexible linkers or loops connecting domains, which allow for conformational changes and interactions with binding partners . Disordered regions are frequently found as flexible linkers or loops connecting domains . IDPs adapt to a dynamic range of rapidly interchanging conformations in vivo according to the cell's conditions, creating a structural or conformational ensemble . Post-translational modifications can regulate the binding affinity of disordered proteins with their receptors, and the flexibility of disordered proteins facilitates the different conformational requirements for binding the modifying enzymes and their receptors . Determining whether MIMI_R557 contains intrinsically disordered regions (IDRs) could provide insights into its function and interactions .

Experimental Approaches to Characterize MIMI_R557

  • Transcriptomics: Examining the transcription profile of the MIMI_R557 gene during different stages of viral infection can provide insights into its expression pattern and regulation .

  • Proteomics: Identifying MIMI_R557 in proteomic analyses of viral particles or infected cells can confirm its expression and localization .

  • Structural Studies: If feasible, determining the three-dimensional structure of MIMI_R557 through X-ray crystallography or NMR spectroscopy could reveal its structural features and potential functional sites.

  • Interaction Studies: Identifying proteins that interact with MIMI_R557 using techniques such as co-immunoprecipitation or yeast two-hybrid assays can provide clues about its role in viral processes.

  • Functional Assays: Developing functional assays based on predicted functions (e.g., enzymatic activity, binding to nucleic acids) can help elucidate the specific role of MIMI_R557.

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to ensure contents settle. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference for your use.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag type, please inform us; we will prioritize its development.
Synonyms
MIMI_R557; Uncharacterized protein R557
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-160
Protein Length
full length protein
Species
Acanthamoeba polyphaga mimivirus (APMV)
Target Names
MIMI_R557
Target Protein Sequence
MSQVTGFDQSNVAQYSSFDPLGSLEHAGSNLGNFIQRNNPFPSLSQSASHTFDDVRSDSG KIFDELKSEADKFYDDAKHGLSDIDYRDFYASDPGNTVLRASMQSPYLNSYMDINNAPNV IPLQAPPIVTNRNSKDYNILFVVVILLLLFVAWRCYVNKR
Uniprot No.

Target Background

Database Links

KEGG: vg:9925192

Subcellular Location
Host membrane; Single-pass membrane protein. Virion.

Q&A

What expression systems are most effective for recombinant MIMI_R557 production?

Multiple expression systems have been successfully employed for mimivirus protein production, with selection depending on research objectives:

Expression SystemAdvantagesConsiderationsTypical Yield
E. coliRapid growth, high yield, cost-effectiveMay lack post-translational modifications, potential inclusion body formation1-5 mg/L culture
Yeast (P. pastoris, S. cerevisiae)Eukaryotic modifications, secretion capabilityLonger production time, glycosylation patterns differ from mammalian0.5-2 mg/L culture
Insect cells (Sf9, Sf21)Complex folding, supports most modificationsHigher cost, technical expertise required0.1-1 mg/L culture
Mammalian cells (293T, CHO)Native-like modifications, optimal foldingHighest cost, lower yield0.05-0.5 mg/L culture

What purification protocols are most suitable for recombinant MIMI_R557?

The purification strategy depends on the expression system and fusion tag used:

  • Affinity Purification Protocol:

    • For His-tagged MIMI_R557:
      a) Lyse cells in buffer containing 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10 mM imidazole
      b) Apply clarified lysate to Ni-NTA resin
      c) Wash with increasing imidazole concentrations (20-50 mM)
      d) Elute with 250-300 mM imidazole
      e) Dialyze against storage buffer (typically Tris-based with 50% glycerol)

  • Membrane Protein Considerations:

    • If MIMI_R557 exhibits membrane association:
      a) Include detergents (0.5-1% DDM or CHAPS) during extraction
      b) Maintain detergent above critical micelle concentration throughout purification
      c) Consider amphipols or nanodiscs for stability studies

  • Quality Control Metrics:

    • Purity assessment by SDS-PAGE (target >90%)

    • Western blot verification using anti-tag antibodies

    • Mass spectrometry confirmation

    • Size-exclusion chromatography for aggregation analysis

The protocol should be optimized based on experimental objectives, with consideration for maintaining native conformation particularly if functional assays are planned .

What methodological approaches can determine the function of MIMI_R557?

A comprehensive functional characterization strategy would include:

  • Bioinformatic Analysis Pipeline:

    • Domain prediction using InterPro, Pfam, and SMART databases

    • Secondary structure prediction via PSIPRED and JPred

    • Hydrophobicity analysis using Kyte-Doolittle plots

    • Homology modeling with Phyre2 or Swiss-Model

    • Comparative genomics across Mimiviridae family members

  • Experimental Functional Analysis:

    • Gene silencing via siRNA (as demonstrated for other mimivirus genes like R458)

    • Protein-protein interaction studies:
      a) Co-immunoprecipitation with viral and host proteins
      b) Yeast two-hybrid screening
      c) Proximity labeling approaches (BioID or APEX)

    • Subcellular localization using immunofluorescence microscopy at different infection stages

    • Structural studies via X-ray crystallography or cryo-EM

  • Phenotypic Assays:

    • Viral fitness assessment in R557-silenced mimivirus

    • Comparative proteomic analysis between wild-type and R557-silenced virus using 2D-DIGE

    • Infection kinetics analysis focusing on eclipse phase timing

    • Assessment of virion morphology via electron microscopy

This multifaceted approach allows researchers to triangulate the function from multiple independent lines of evidence, a strategy that has proven successful for other uncharacterized viral proteins .

How can gene silencing techniques be optimized to study MIMI_R557 function?

Based on successful silencing studies of other mimivirus genes (e.g., R458) , a methodological approach for MIMI_R557 silencing would include:

  • siRNA Design Considerations:

    • Target 3-4 different regions within the MIMI_R557 coding sequence

    • Design 21-23 nucleotide siRNAs with 2-nt 3' overhangs

    • Verify specificity against the mimivirus genome and host Acanthamoeba

    • Control siRNAs: scrambled sequence and siRNA targeting another mimivirus gene

  • Transfection Protocol:

    • Pre-infect Acanthamoeba cells with mimivirus at MOI 10

    • Transfect with siRNA (50-100 nM) using lipofection

    • Include appropriate controls:
      a) Mock-transfected infected cells
      b) Non-targeting siRNA transfected infected cells
      c) Uninfected cells

  • Validation and Phenotypic Analysis:

    • Confirm silencing efficiency by RT-qPCR (target >70% reduction)

    • Western blot analysis using antibodies against MIMI_R557 (if available)

    • Viral growth curve analysis:
      a) Sample at multiple timepoints (0, 4, 8, 12, 16, 24h post-infection)
      b) Quantify by TCID50 assay

    • Microscopy analysis of viral factory formation

    • Electron microscopy to assess virion morphology

  • Downstream Analysis:

    • Comparative proteomics using 2D-DIGE as described for R458

    • RNA-Seq to identify gene expression changes

    • Co-silencing with functionally related genes to identify synergistic effects

This approach enables rigorous assessment of phenotypic changes while controlling for off-target effects and establishing causality between the silenced gene and observed phenotypes .

What bioinformatic approaches can predict the function of MIMI_R557?

A comprehensive computational strategy for uncharacterized protein annotation would include:

  • Sequence-Based Prediction Pipeline:

    • PSI-BLAST against non-redundant protein databases

    • HHpred for sensitive remote homology detection

    • InterProScan for integrated domain analysis

    • TMHMM and SignalP for transmembrane and signal peptide prediction

    • Coiled-coil prediction using COILS or Paircoil2

    • Intrinsically disordered region prediction via IUPred2A

    • Functional site prediction using ScanProsite and MOTIF

  • Structure-Based Prediction:

    • Ab initio modeling with I-TASSER or Rosetta

    • Template-based modeling using Phyre2 or SWISS-MODEL

    • Structural comparison using DALI or FATCAT

    • Binding pocket prediction with CASTp or COACH

    • Electrostatic surface analysis using APBS

  • Systems Biology Approaches:

    • Gene neighborhood analysis in the mimivirus genome

    • Co-expression pattern analysis with known viral genes

    • Protein-protein interaction prediction using STRING

    • Integrative functional prediction via SIFTER or PANNZER

  • Machine Learning Integration:

    • Ensemble methods combining multiple predictors

    • Deep learning approaches for feature extraction from sequence

    • Genomic context-based predictions

This strategic combination of methods has successfully annotated 46 previously uncharacterized proteins in other systems by integrating multiple lines of computational evidence . The prediction should achieve at least 83.6% accuracy according to receiver operating characteristic analyses reported in the literature.

How might MIMI_R557 contribute to the mimivirus replication cycle based on genomic location?

Analysis of the genomic context of MIMI_R557 provides insights into its potential functional role:

  • Genomic Context Analysis:

    • The "R" designation indicates rightward transcription directionality

    • R557 is positioned in a genomic region containing several genes involved in:
      a) Post-translational modifications
      b) Membrane-associated functions
      c) Potential packaging or virion assembly roles

  • Comparative Analysis with Related Proteins:

    • Similar uncharacterized proteins (R556, R513, R306) are expressed during infection and may function in:
      a) Viral transcription machinery
      b) Host immune modulation
      c) Virion structural components

    • Some R-designated proteins contribute to unique mimivirus features like the starfish structure

  • Integration with Replication Cycle Knowledge:

    • Mimivirus establishes viral factories where genome replication occurs

    • The genome packaging involves a unique "segro-packasome" machinery

    • The C-terminal hydrophobic region of MIMI_R557 suggests potential involvement in:
      a) Viral factory membrane association
      b) Virion membrane insertion
      c) Host-viral membrane interactions during entry/exit

  • Temporal Expression Pattern Inference:

    • Based on similar proteins, MIMI_R557 may be expressed:
      a) Early: suggesting roles in host manipulation
      b) Middle: indicating replication function
      c) Late: suggesting structural or packaging roles

This contextual analysis suggests MIMI_R557 may function at the interface of viral replication and assembly, potentially contributing to the unique membrane structures observed during mimivirus infection .

What proteomic approaches can identify interaction partners of MIMI_R557?

A comprehensive proteomics strategy to identify MIMI_R557 interaction partners would include:

  • Affinity Purification-Mass Spectrometry (AP-MS):

    • Protocol Design:
      a) Express tagged MIMI_R557 (e.g., FLAG, HA, or BioID fusion) in:

      • Recombinant mimivirus system

      • Transfected Acanthamoeba cells during infection
        b) Crosslink if interactions are transient (formaldehyde, DSS, or photoreactive)
        c) Lyse cells under conditions preserving interactions (mild detergents)
        d) Immunoprecipitate with anti-tag antibodies
        e) Wash stringently to remove non-specific interactions
        f) Elute and analyze by LC-MS/MS

    • Controls and Validation:
      a) Untagged MIMI_R557 expression
      b) Tag-only expression
      c) Unrelated mimivirus protein with same tag
      d) Reciprocal tagging of identified partners

  • Proximity-Based Approaches:

    • BioID Method:
      a) Generate MIMI_R557-BioID2 fusion
      b) Express during infection, supply biotin
      c) Purify biotinylated proteins using streptavidin
      d) Identify by mass spectrometry

    • APEX2 Method:
      a) Create MIMI_R557-APEX2 fusion
      b) Brief treatment with biotin-phenol and H₂O₂
      c) Rapid labeling of proximal proteins
      d) Purify and identify labeled proteins

  • Crosslinking Mass Spectrometry (XL-MS):

    • Use membrane-permeable crosslinkers (DSS, BS3)

    • Enrich for MIMI_R557-containing complexes

    • Digest and identify crosslinked peptides

    • Map interaction interfaces at amino acid resolution

  • Data Analysis Strategy:

    • Implement SAINT or CompPASS algorithms for specificity scoring

    • Compare against viral-host protein interaction databases

    • Functional enrichment analysis of interaction partners

    • Network analysis to identify protein complexes

This multi-method approach provides complementary data on stable and transient interactions, addressing limitations of individual techniques and providing confidence in identified partners .

How can contradictions in experimental results for MIMI_R557 be resolved methodologically?

When faced with contradictory data regarding MIMI_R557 function or interactions, implement the following structured approach:

  • Methodological Reconciliation Framework:

    • Systematic Comparison of Experimental Conditions:
      a) Create a detailed comparison table of all methods including:

      • Expression systems used (E. coli vs. eukaryotic systems)

      • Tags and their positions (N vs. C-terminal)

      • Buffer conditions (detergents, salt concentration)

      • Interaction detection methods (direct vs. indirect)
        b) Identify key variables that differ between contradictory studies

    • Validation Through Orthogonal Methods:
      a) If protein-protein interactions show discrepancies:

      • Confirm with both in vitro (pull-down) and in vivo (co-IP) approaches

      • Employ label-free techniques like SPR or ITC

      • Map interaction domains through truncation constructs
        b) If localization data conflicts:

      • Compare fixation methods (paraformaldehyde vs. methanol)

      • Use live-cell imaging with multiple tag types

      • Perform subcellular fractionation as biochemical validation

  • Statistical Analysis of Contradictory Data:

    • Implement quantitative comparison using receiver operating characteristics (83.6% threshold)

    • Apply surrogate data approaches to detect nonlinear components in time-series data

    • Utilize factor analysis to determine if hidden variables explain contradictions

  • Integrated Experimental Design:

    • Control for Technical Variables:
      a) Systematic assessment of tag interference:

      • Compare N-terminal, C-terminal, and internal tags

      • Include tag-free validation where possible
        b) Test multiple lysis conditions particularly for membrane-associated proteins

    • Biological Context Considerations:
      a) Examine time-course of infection (contradictions may reflect temporal dynamics)
      b) Compare results between different Acanthamoeba strains
      c) Assess influence of viral load on results (as mimivirus production is affected by initial viral doses)

This structured approach helps distinguish genuine biological complexity from methodological artifacts, a particularly important consideration for membrane-associated proteins like MIMI_R557 .

What is the potential relationship between MIMI_R557 and the unique starfish-shaped feature of mimivirus?

The relationship between MIMI_R557 and the mimivirus starfish structure warrants systematic investigation:

  • Structural Analysis of the Starfish Feature:

    • The starfish-shaped feature is a unique pentameric vertex structure in mimivirus

    • It has the following characteristics:
      a) Five arms with thickness of approximately 400 Å
      b) Width of about 500 Å
      c) Extension of approximately 2,000 Å toward neighboring 5-fold vertices
      d) Insertion between neighboring faces associated with a special vertex
      e) Absence of the hexagonal arrays of depressions seen in capsid proteins

  • Experimental Approaches to Test MIMI_R557 Involvement:

    • Localization Studies:
      a) Immunogold electron microscopy using antibodies against MIMI_R557
      b) Correlative light and electron microscopy with fluorescently tagged MIMI_R557
      c) Subtomogram averaging of virion vertices to detect MIMI_R557 density

    • Functional Studies:
      a) R557 gene silencing followed by virion structure analysis
      b) Mutagenesis of key MIMI_R557 residues and assessment of starfish assembly
      c) In vitro reconstitution assays with purified components

    • Interaction Analysis:
      a) Proximity labeling centered on the starfish vertices
      b) Crosslinking mass spectrometry of purified virions
      c) Immunoprecipitation of MIMI_R557 from partially disassembled virions

  • Structural Modeling Integration:

    • Fit MIMI_R557 structure models into cryo-EM density of the starfish feature

    • Assess oligomerization potential through computational docking

    • Simulate membrane interactions of the hydrophobic C-terminus in relation to the starfish structure

  • Functional Implications for Genome Packaging:

    • The starfish structure is hypothesized to regulate genome delivery to the host

    • If MIMI_R557 is a component, it may contribute to:
      a) Sealing the special vertex until host entry
      b) Participating in genome packaging through the unique portal system
      c) Mediating conformational changes during infection

This methodological framework would resolve whether MIMI_R557 is structurally involved in this critical and unique feature of mimivirus architecture .

How can structural studies of MIMI_R557 be optimized for membrane-associated viral proteins?

Structural characterization of membrane-associated viral proteins like MIMI_R557 requires specialized approaches:

  • Sample Preparation Optimization:

    • Expression Strategies:
      a) Cell-free expression systems with nanodiscs or liposomes
      b) Insect cell expression with lipid supplementation
      c) Mammalian expression for native post-translational modifications

    • Purification Approaches:
      a) Detergent screening panel (DDM, LMNG, CHAPS, etc.)
      b) Amphipol exchange for detergent-free stabilization
      c) Nanodiscs or lipid nanodiscs for native-like environment
      d) GraDeR technique for detergent removal and gradient purification

  • Structural Biology Methods:

    • X-ray Crystallography Adaptations:
      a) Lipidic cubic phase crystallization
      b) Crystal dehydration techniques
      c) Antibody fragment co-crystallization to increase polar surfaces

    • Cryo-EM Approaches:
      a) Direct single-particle analysis in nanodiscs
      b) Subtomogram averaging from virus particles
      c) Phase plate imaging for improved contrast
      d) 2D crystallization for electron crystallography

    • NMR Strategies:
      a) Selective isotope labeling of methyl groups
      b) TROSY-based experiments for larger systems
      c) Solid-state NMR for membrane-embedded regions

  • Computational Integration:

    • Molecular dynamics simulations in explicit membranes

    • Hybrid modeling combining experimental restraints

    • Enhanced sampling techniques for conformational space exploration

  • Validation Strategy:

    • Functional Assays:
      a) Liposome binding or fusion assays
      b) Electrophysiology for channel activity
      c) Thermostability assays in different membrane mimetics

    • Biophysical Validation:
      a) Hydrogen-deuterium exchange mass spectrometry
      b) Crosslinking mass spectrometry
      c) Electron paramagnetic resonance for dynamics

This comprehensive approach addresses the specific challenges of membrane protein structural biology while generating information directly relevant to MIMI_R557's potential role in the viral membrane interactions .

What role might MIMI_R557 play in mimivirus genome packaging based on comparative analysis?

A systematic analysis of mimivirus genome packaging machinery and potential involvement of MIMI_R557:

  • Mimivirus Genome Packaging Mechanism:

    • Mimivirus uses a "segro-packasome" complex for genome packaging

    • Key components include:
      a) Packaging ATPase (related to FtsK/SPOIIIE/HerA)
      b) Three putative recombinases
      c) Type II topoisomerase
      d) Potentially unidentified components

  • Comparative Analysis Framework:

    • Genomic Context Analysis:
      a) Compare genomic position of MIMI_R557 relative to known packaging genes
      b) Assess co-expression patterns during infection
      c) Evaluate evolutionary conservation across Mimiviridae family

    • Protein Feature Comparison:
      a) Analyze sequence similarity with known packaging components
      b) Search for DNA-binding motifs (e.g., KilA-N domain seen in other R-designated proteins)
      c) Identify potential interaction domains for packaging machinery proteins

  • Experimental Testing Strategy:

    • DNA-Binding Assessment:
      a) Electrophoretic mobility shift assays
      b) Fluorescence anisotropy with labeled DNA
      c) Chromatin immunoprecipitation during viral replication

    • Interaction Studies:
      a) Yeast two-hybrid screening against known packaging components
      b) Co-immunoprecipitation during active packaging
      c) In vitro reconstitution of sub-complexes

    • Functional Impact Analysis:
      a) R557 silencing effect on DNA packaging efficiency
      b) Visualization of genome organization in viral factory using fluorescence microscopy
      c) Atomic force microscopy of packaged vs. unpackaged genomes

  • Integration with Existing Knowledge:

    • The mimivirus has a unique two-portal system for genome packaging and delivery

    • Mimivirus genome packaging may involve genome concatemer resolution

    • Membrane interactions during packaging are poorly understood but critical

This methodological framework would determine if MIMI_R557 participates in the unique genomic packaging process of mimivirus, potentially as an unidentified component of the segro-packasome machinery .

What are the optimal conditions for mimivirus cultivation to study MIMI_R557 expression?

Optimizing mimivirus cultivation is critical for studying MIMI_R557 expression and function:

  • Host Cell Culture Conditions:

    • Acanthamoeba Species Selection:
      a) A. polyphaga: Original host with established protocols
      b) A. castellanii: Alternative host with potentially different protein expression
      c) A. griffini and A. lenticulata: Confirmed alternative hosts

    • Growth Medium Composition:
      a) PPYG (Proteose peptone, yeast extract, glucose) medium
      b) PYG with serum supplementation
      c) Optimal pH range: 6.8-7.2

  • Viral Infection Parameters:

    • Optimal Multiplicity of Infection (MOI):
      a) For maximum infectious particle production: Low MOI (0.01-0.1)
      b) For maximum total particle production: Higher MOI (1-10)
      c) For synchronized infection: MOI ≥10

    • Harvest Timing Optimization:
      a) Early protein expression: 4-8 hours post-infection
      b) Late protein expression: 12-16 hours post-infection
      c) Maximum viral yield: 16-24 hours post-infection

  • Critical Quality Parameters:

    • Production Efficiency Metrics:
      a) Ratio of infectious to total particles: Typically yields up to 5000 TCID50 per inoculated TCID50
      b) Genomic DNA quantification by qPCR
      c) Cytopathic effect (CPE) observation timeline

    • Quality Control Methods:
      a) TCID50 titration for infectious particle quantification
      b) qPCR for viral genome quantification
      c) Negative staining EM for morphological assessment

  • Specific MIMI_R557 Considerations:

    • Temporal expression pattern analysis by RT-qPCR

    • Protein accumulation monitoring by Western blot

    • Subcellular localization tracking by immunofluorescence

This optimization framework ensures reliable and reproducible conditions for studying MIMI_R557 expression patterns and functional roles during mimivirus infection .

How can recombinant MIMI_R557 be optimized for structural and functional studies?

A systematic approach to optimize recombinant MIMI_R557 production:

  • Construct Design Optimization:

    • Expression Vector Elements:
      a) Promoter selection: T7 for E. coli, AOX1 for P. pastoris, polyhedrin for baculovirus
      b) Codon optimization for expression host
      c) Fusion tag strategic placement:

      • N-terminal tags if C-terminus contains transmembrane domain

      • Consider removable tags with TEV or PreScission protease sites

    • Protein Engineering:
      a) Truncation constructs removing potential disordered regions
      b) Surface entropy reduction for crystallization
      c) Cysteine-to-serine mutations to prevent non-native disulfide bonds

  • Expression Condition Screening:

    • E. coli Expression Parameters:
      a) Temperature optimization (18°C, 25°C, 30°C, 37°C)
      b) Induction conditions (IPTG concentration: 0.1-1.0 mM)
      c) Media formulations (LB, TB, auto-induction media)
      d) Specialized strains (Rosetta-GAMI for disulfide formation, C41/C43 for membrane proteins)

    • Eukaryotic Expression Parameters:
      a) Cell density at transfection/infection
      b) Expression duration optimization
      c) Additive screening (glycerol, arginine, detergents)

  • Purification Strategy Development:

    • Solubilization Screening:
      a) Detergent panel (DDM, LMNG, CHAPS, Triton X-100)
      b) Solubilization time and temperature
      c) Salt and pH optimization

    • Chromatography Development:
      a) Multi-step purification scheme development
      b) Buffer optimization for stability
      c) Storage condition optimization

  • Quality Assessment Metrics:

    • Purity Analysis:
      a) SDS-PAGE with densitometry (target >95%)
      b) Size-exclusion chromatography
      c) Dynamic light scattering for aggregation assessment

    • Functional Verification:
      a) Circular dichroism for secondary structure
      b) Thermal shift assays for stability
      c) Activity assays based on predicted function

This comprehensive optimization framework significantly increases the likelihood of obtaining high-quality recombinant MIMI_R557 suitable for downstream structural and functional characterization .

What detection methods are most sensitive for analyzing MIMI_R557 expression during mimivirus infection?

A comparison of detection methodologies for monitoring MIMI_R557 during infection:

  • Nucleic Acid-Based Detection:

    • RT-qPCR Approach:
      a) Target-specific primers designed against conserved regions
      b) Absolute quantification using standard curve
      c) Sensitivity: Can detect as few as 10-100 copies
      d) Controls: Host housekeeping genes, viral early and late genes

    • RNA-Seq Analysis:
      a) Global transcriptomic profiling during infection course
      b) Differential expression analysis between timepoints
      c) Co-expression network construction with known genes
      d) Normalization strategy: RPKM/FPKM with spike-in controls

  • Protein-Based Detection:

    • Western Blot Optimization:
      a) Antibody options:

      • Custom anti-MIMI_R557 antibodies

      • Anti-tag antibodies for recombinant studies
        b) Enhanced sensitivity methods:

      • Chemiluminescence with signal amplification

      • Fluorescent secondary antibodies

      • Capillary-based automated Western systems

    • Mass Spectrometry Approaches:
      a) Targeted proteomics:

      • Selected reaction monitoring (SRM)

      • Parallel reaction monitoring (PRM)
        b) Sample preparation optimization:

      • FASP (filter-aided sample preparation)

      • Optimized digestion for membrane proteins
        c) Label-free quantification strategies

  • Imaging-Based Detection:

    • Immunofluorescence Microscopy:
      a) Fixation optimization for membrane proteins
      b) Signal amplification with tyramide signal amplification
      c) Colocalization analysis with viral factory markers

    • Advanced Microscopy Techniques:
      a) Super-resolution approaches (STORM, PALM)
      b) Correlative light and electron microscopy
      c) Live-cell imaging with tagged constructs

  • Sensitivity and Specificity Comparison:

MethodDetection LimitAdvantagesLimitations
RT-qPCR10-100 copiesHigh sensitivity, quantitativeDetects transcript only
Western blot~1-10 ng proteinProtein size informationRequires specific antibody
SRM/PRM~50-100 fmolHigh specificity, multiplexComplex method development
Immunofluorescence~1000 molecules/cellSpatial informationResolution limitations

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.