Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein R571 (MIMI_R571)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested. Advance notice and additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MIMI_R571; Uncharacterized protein R571
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-297
Protein Length
full length protein
Species
Acanthamoeba polyphaga mimivirus (APMV)
Target Names
MIMI_R571
Target Protein Sequence
MENSTPKKISESQIKNLALSGGGFYGFAVVGALKEIFDNYIDPNNIKTISGVSVGSIIAT MLAIGYSIDEITKIMFEIDMDTLIKDSYFSYYTLWEKFGMYNADKLEQEIERIIRDKTHI KNCTFSQIEKNLIIVTTNLNYQRTRIFSKLETPTMIISKAVRMSISYPFIMVPVLFEGDL YGDGGETLNYPITLFDDDLDKTIGITFANHNENDDGTLKTRLPINNFYDYIVSLGLTMNR SSYISQISSKYLDRSIVIKINEDISSMQFNLDLKQKEYLFECGIKSVKQQIIKLINH
Uniprot No.

Target Background

Function

Probable lipid hydrolase.

Database Links

KEGG: vg:9925207

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • How does MIMI_R571 fit into the broader context of Mimivirus genomics?

    Mimivirus has one of the largest viral genomes sequenced to date (~1.2 million base pairs encoding over 1,000 predicted proteins) , blurring the boundary between viruses and cellular organisms. Uncharacterized proteins like R571 represent a significant portion of the mimivirus proteome.

    The mimivirus genome contains many genes not typically found in viruses, including components of the translation apparatus such as aminoacyl-tRNA synthetases . While mimivirus lineages (A, B, and C) show conservation of core genes, there are variations in gene content that may reflect adaptation to different hosts or environments .

    The R571 gene appears to be conserved across mimivirus strains, suggesting it may serve an important function, though it has not been identified as essential through gene knockout studies reported in the available literature .

  • What approaches are used to express recombinant MIMI_R571 for research applications?

    Recombinant MIMI_R571 is typically expressed using the following methodology:

    1. Gene synthesis or cloning: The MIMI_R571 gene sequence is optimized for expression in the chosen host system (typically E. coli)

    2. Expression vector construction: The gene is cloned into an expression vector (such as pET-28a) with an appropriate tag (often His-tag) for purification purposes

    3. Host transformation and expression: The recombinant plasmid is transformed into an expression host like E. coli BL21(DE3), and protein expression is induced (typically with IPTG for T7-based systems)

    4. Protein purification: The recombinant protein is purified using affinity chromatography (Ni-NTA for His-tagged proteins), followed by additional chromatographic steps if needed

    5. Quality control: The purified protein undergoes validation through SDS-PAGE, Western blotting, and mass spectrometry to confirm identity and purity

    The final product is typically stored in a Tris-based buffer with 50% glycerol at -20°C for short-term use or -80°C for extended storage .

  • What bioinformatic approaches can help predict the function of uncharacterized proteins like MIMI_R571?

    Modern bioinformatic approaches to characterize proteins like MIMI_R571 include:

    1. Sequence-based analysis:

      • Homology searches using BLAST or HMMer against protein databases

      • Motif identification using PROSITE, Pfam, or InterProScan

      • Analysis of conserved domains using CDD or SMART

    2. Structure prediction and analysis:

      • Ab initio structure prediction using AlphaFold2 or RoseTTAFold

      • Template-based modeling using I-TASSER or SWISS-MODEL

      • Structural comparison using DALI or TM-align

    3. Advanced computational approaches:

      • Graph Convolutional Networks (GCNs) for structure-based function prediction

      • Language models pretrained on protein sequences (like LSTM-LM) that extract residue-level features from sequences to boost function prediction

    Recent research has shown that combining sequence information with predicted structural features significantly improves function prediction accuracy. For example, researchers demonstrated that using GCNs with features extracted from a pretrained LSTM language model achieved 40% higher accuracy than traditional methods for predicting functions of proteins with limited sequence identity to known proteins .

Intermediate Research Questions

  • What experimental approaches are most effective for characterizing the function of MIMI_R571?

    The most effective experimental strategy employs a multi-faceted approach:

    1. Biochemical characterization:

      • Enzymatic assays based on the EC 3.1.1.- classification (esterase activity tests with various substrates)

      • Substrate specificity determination using substrate libraries

      • Kinetic parameter measurements (Km, Vmax, kcat)

    2. Structural biology approaches:

      • X-ray crystallography or cryo-EM for high-resolution structure determination

      • Circular dichroism to analyze secondary structure elements

      • NMR for dynamic structure analysis and ligand binding studies

    3. Interaction studies:

      • Co-immunoprecipitation with viral and host proteins

      • Yeast two-hybrid or proximity labeling to identify interaction partners

      • Surface plasmon resonance to quantify binding affinities

    4. Cellular assays:

      • Localization studies using fluorescently tagged versions of the protein

      • Expression knockdown using siRNA to assess impact on viral replication

      • Expression timing during viral infection cycle

    Recent studies employing these approaches have revealed that seemingly uncharacterized mimivirus proteins often play crucial roles in viral replication. For example, R458, another previously uncharacterized mimivirus protein, was found to function as a translation initiation factor, and its silencing resulted in deregulation of 32 other viral proteins and delayed viral factory formation .

  • How does studying proteins like MIMI_R571 contribute to our understanding of giant virus evolution?

    Research on proteins like MIMI_R571 provides insights into viral evolution through:

    1. Genomic archaeology: Identifying potential horizontal gene transfers between viruses, prokaryotes, and eukaryotes

    2. Functional innovation: Understanding how novel proteins emerge and acquire new functions

    3. Evolutionary relationships: Establishing connections between different viral families and possible ancestry

    4. Host adaptation mechanisms: Revealing how viruses adapt to different host environments

    A particularly interesting finding from studying mimivirus proteins is the identification of an MC1-like DNA architectural protein (gp275) that shows homology to archaeal proteins, suggesting complex evolutionary relationships between viruses and prokaryotes . Similarly, MIMI_R571 may represent a protein that evolved either through horizontal gene transfer or de novo gene birth.

    Comparative analysis of protein homologs across mimivirus lineages reveals that:

    MechanismExamples in MimivirusRelevance to MIMI_R571
    Gene duplicationAminoacyl-tRNA synthetases May explain origin if paralogs exist
    Horizontal gene transferMC1-like protein (archaeal origin) Possible mechanism if distant homologs found
    De novo gene birthUnique hypothetical proteinsLikely if no homologs exist outside mimiviruses
    Gene lossGenome reduction in laboratory conditions May explain function if missing in some strains
  • What is known about the expression and regulation of MIMI_R571 during viral infection?

    Based on transcriptomic studies of mimivirus infection in Acanthamoeba, viral gene expression follows a temporal program that can be divided into early, intermediate, and late phases . Although specific data for MIMI_R571 is limited in the provided search results, we can infer its regulation pattern based on similar uncharacterized proteins:

    1. Temporal expression: Most mimivirus genes show distinct expression patterns:

      • Early genes (0-3 hours post-infection): DNA replication, transcription factors

      • Intermediate genes (3-6 hours post-infection): Translation machinery, nucleotide metabolism

      • Late genes (6+ hours post-infection): Structural proteins, proteases

    2. Regulation mechanisms: Expression is likely controlled by:

      • Promoter sequence elements specific to different temporal classes

      • Viral transcription factors

      • Possible regulation by host factors

    3. Localization: Based on studies of other mimivirus proteins:

      • May localize to viral factories within the cytoplasm

      • May be packaged into mature virions if functional during early infection stages

    Transcriptomic analysis of mimivirus infection shows that genes related to transcription, translation, and nucleotide metabolism are typically upregulated in early to intermediate stages, while structural proteins and enzymes involved in host interaction predominate in later stages . Understanding MIMI_R571's expression pattern would provide clues to its functional role.

  • How reliable are protein-protein interaction studies involving uncharacterized viral proteins like MIMI_R571?

    Protein-protein interaction (PPI) studies with uncharacterized viral proteins present specific challenges and have varying reliability depending on the methodology used:

    MethodEstimated True Positive RateLimitations with Viral ProteinsSolutions
    Yeast Two-Hybrid (Y2H)50-70% Potential toxicity in yeast; may miss context-dependent interactionsUse multiple bait constructs; validate with other methods
    Co-immunoprecipitation>80% Requires good antibodies; may isolate indirect interactionsUse tagged proteins; employ stringent washing
    Proximity labeling (BioID)>70% (estimated)May identify spatial neighbors without direct bindingUse short labeling times; validate with direct binding assays
    Affinity purification-MS>80% Complex data analysis; may include contaminantsUse quantitative approaches (SILAC, TMT); employ statistical filtering

    To maximize reliability when studying MIMI_R571 interactions:

    1. Apply multiple orthogonal methods rather than relying on a single approach

    2. Include appropriate controls (unrelated viral proteins and negative control strains)

    3. Validate key interactions with functional assays

    4. Consider contextual factors (timing during infection, compartmentalization)

    5. Use quantitative scoring to distinguish high-confidence from low-confidence interactions

    Research indicates that interactions identified by multiple methods are significantly more reliable (>90% true positive rate) than those identified by a single method, particularly for novel or uncharacterized proteins .

Advanced Research Questions

  • What role might MIMI_R571 play in mimivirus genome organization and packaging?

    Given mimivirus's complex genome packaging mechanisms, MIMI_R571 may potentially be involved in genome organization based on several lines of evidence and comparative analysis:

    1. Genome packaging machinery: Mimivirus employs prokaryotic-like chromosome segregation machinery for genome packaging , and as an uncharacterized protein with potential enzymatic activity (EC 3.1.1.-), MIMI_R571 could participate in this process.

    2. DNA-associated proteins in mimivirus: Recent research identified an MC1-like DNA architectural protein (gp275) involved in DNA condensation within the mimivirus capsid . This raises the possibility that other uncharacterized proteins like MIMI_R571 might have complementary roles in genome organization.

    3. DNA processing requirements:

      • Mimivirus produces hundreds of genome copies in viral factories that must be disentangled

      • The segro-packasome complex resolves concatenated DNA forms during packaging

      • Recombination, topoisomerase activity, and other DNA-modifying functions are required

    4. Methodological approaches to test this hypothesis:

      • ChIP-seq or DNA pulldown assays to detect DNA-binding capability

      • In vitro DNA condensation assays (as performed with gp275 )

      • Subcellular localization during infection using fluorescent tagging

      • siRNA silencing to observe effects on viral DNA packaging

    The hypothesis that MIMI_R571 might function in genome organization would be consistent with the finding that mimivirus encodes various DNA-binding and processing proteins, including recombinases and topoisomerases, that function in genome segregation and packaging .

  • How can structural biology approaches help determine the function of MIMI_R571?

    Structural biology offers powerful tools for elucidating MIMI_R571 function through the following methodological approaches:

    1. High-resolution structure determination:

      • X-ray crystallography requires producing diffraction-quality crystals of purified MIMI_R571

      • Cryo-EM is particularly useful for proteins resistant to crystallization or in complexes

      • NMR spectroscopy for smaller domains and dynamic regions

    2. Structure-based function prediction:

      • Active site identification and analysis

      • Structural similarity searches against PDB using DALI or VAST

      • Molecular docking with potential substrates based on EC 3.1.1.- classification

    3. Advanced computational approaches:

      • Graph Convolutional Networks (GCNs) for structure-based function prediction show superior performance to sequence-based methods

      • AlphaFold2-predicted structures can be used as input for GCN-based function prediction

    4. Experimental validation:

      • Site-directed mutagenesis of predicted catalytic residues

      • Activity assays with predicted substrates

      • Binding studies with potential interaction partners

    A structured approach might employ:

    Phase 1: Generate AlphaFold2 structure prediction to guide experimental work

    Phase 2: Express, purify, and determine experimental structure

    Phase 3: Identify potential functional sites through computational analysis

    Phase 4: Validate predictions through biochemical and cellular assays

    This integrated approach has proven successful for other uncharacterized viral proteins, leading to functional annotations and mechanistic insights .

  • What challenges exist in developing antibodies against MIMI_R571 for research applications?

    Developing effective antibodies against viral proteins like MIMI_R571 presents several methodological challenges:

    1. Antigen design considerations:

      • Optimal epitope selection for surface accessibility

      • Production of properly folded protein or appropriate peptide fragments

      • Potential post-translational modifications affecting epitopes

    2. Production methodology options:

      ApproachAdvantagesLimitationsApplication to MIMI_R571
      PolyclonalRecognizes multiple epitopes; robust detectionBatch variability; limited quantityUseful for initial detection and localization
      MonoclonalConsistent; unlimited supply; epitope-specificMore expensive; longer development timeIdeal for specific functional studies
      RecombinantPrecisely defined binding regions; customizableTechnical complexity; expression challengesBest for targeting specific domains
    3. Validation protocols:

      • Western blot against recombinant protein and viral lysates

      • Immunoprecipitation efficiency testing

      • Specificity verification against related mimivirus proteins

      • Immunofluorescence to confirm expected localization patterns

    4. Special considerations for MIMI_R571:

      • Being an uncharacterized protein, optimal epitope selection is challenging

      • Expression timing during infection affects detection sensitivity

      • Potential homology with host proteins requires careful specificity testing

    5. Alternative approaches:

      • Epitope tagging of the native protein (if genetic manipulation of the virus is possible)

      • Proximity labeling approaches that don't require specific antibodies

      • Mass spectrometry-based detection and quantification

    Recent studies with mimivirus proteins have shown that antibodies developed against recombinant proteins can be valuable tools for tracking viral infection dynamics, as demonstrated with mimivirus translation initiation factor studies .

  • How might gene silencing approaches be used to study the function of MIMI_R571?

    Gene silencing techniques offer powerful approaches to investigate MIMI_R571 function in the context of viral infection:

    1. siRNA-based silencing methodology:

      • Design 3-4 siRNAs targeting different regions of MIMI_R571 mRNA

      • Transfect siRNAs into host cells (Acanthamoeba) prior to infection

      • Include appropriate controls (non-targeting siRNA, siRNA targeting known essential genes)

      • Validate knockdown efficiency using RT-qPCR and Western blot

    2. Phenotypic analysis of silenced infections:

      • Monitor viral replication kinetics through plaque assays or qPCR

      • Assess viral factory formation using immunofluorescence microscopy

      • Analyze viral protein expression profiles using proteomics

      • Examine virion morphology using electron microscopy

    This approach has been successfully applied to mimivirus protein R458, revealing its role as a translation initiation factor. Silencing R458 resulted in:

    • Delayed eclipse phase (by at least 2 hours)

    • Deregulation of 32 viral proteins (both up- and downregulation)

    • Effects on viral particle structures and transcriptional machinery

    1. Complementary approaches:

      • Rescue experiments by expressing siRNA-resistant MIMI_R571 variants

      • Domain-specific silencing to identify critical functional regions

      • Combinatorial silencing with functionally related genes

    2. Analysis of differential protein expression:

      • Two-dimensional difference-in-gel electrophoresis (2D-DIGE)

      • Mass spectrometry for protein identification

      • Pathway analysis of affected proteins

    This methodological framework provides a comprehensive approach to determining MIMI_R571's role in the mimivirus replication cycle.

Technical and Methodological Questions

  • What quality control measures ensure the reliability of recombinant MIMI_R571 for research applications?

    A robust quality control framework for recombinant MIMI_R571 should include:

    1. Identity verification:

      • SDS-PAGE for molecular weight confirmation

      • Western blot with tag-specific or protein-specific antibodies

      • Mass spectrometry for peptide mass fingerprinting and sequence coverage

      • N-terminal sequencing for confirmation of the first 5-10 amino acids

    2. Purity assessment:

      • Densitometry analysis of SDS-PAGE (>90% purity standard)

      • Size-exclusion chromatography to detect aggregates or degradation products

      • Endotoxin testing if intended for cell-based assays

      • Host cell protein (HCP) ELISA to quantify contaminating proteins

    3. Functional characterization:

      • Activity assays based on predicted function (esterase activity for EC 3.1.1.-)

      • Thermal shift assays to assess proper folding and stability

      • Circular dichroism to confirm secondary structure elements

      • Dynamic light scattering for homogeneity assessment

    4. Storage stability validation:

      • Accelerated stability studies at different temperatures

      • Freeze-thaw cycle testing (typically up to 5 cycles)

      • Long-term stability monitoring with activity retention measurement

    5. Batch consistency:

      • Lot-to-lot comparison using a reference standard

      • Certificate of Analysis (CoA) with standardized acceptance criteria

    For optimal results, recombinant MIMI_R571 should be stored in Tris-based buffer with 50% glycerol at -20°C for short-term use or -80°C for extended storage, with working aliquots kept at 4°C for up to one week .

  • How can transcriptomic and proteomic approaches illuminate the function of MIMI_R571 in the context of mimivirus infection?

    Integrated transcriptomic and proteomic approaches offer comprehensive insights into MIMI_R571 function:

    1. Transcriptomic methodology:

      • RNA-seq of infected cells at multiple time points post-infection

      • Analysis of differential expression between wild-type and MIMI_R571-silenced infections

      • Co-expression network analysis to identify functionally related genes

      • Comparative transcriptomics across mimivirus strains

    Recent transcriptomic analysis of Acanthamoeba polyphaga during mimivirus infection revealed:

    • Distinct temporal patterns of host and viral gene expression

    • Downregulation of host cytoskeleton and DNA replication genes

    • Upregulation of host genes associated with the ubiquitin-proteasome system

    1. Proteomic methodology:

      • Quantitative proteomics using SILAC or TMT labeling

      • Pulse-chase experiments to track protein synthesis dynamics

      • Protein-protein interaction mapping using proximity labeling or co-immunoprecipitation

      • Post-translational modification analysis

    2. Integration strategies:

      • Correlation analysis between transcript and protein abundance

      • Pathway enrichment analysis for coordinated responses

      • Temporal clustering of expression patterns

      • Network analysis to identify functional modules

    3. Application to MIMI_R571:

      • Determine expression timing to classify as early, intermediate, or late gene

      • Identify co-regulated genes that may share functional relationships

      • Compare effects of MIMI_R571 silencing on global expression patterns

      • Analyze protein complexes containing MIMI_R571

    This multi-omics approach has successfully revealed functional insights for other mimivirus proteins, as demonstrated by studies showing that mimivirus infection causes cell cycle arrest in the host and extensive remodeling of host cellular pathways .

  • What are the best experimental designs for assessing the essential nature of MIMI_R571 in the mimivirus life cycle?

    Determining whether MIMI_R571 is essential for the mimivirus life cycle requires a systematic experimental approach:

    1. Gene knockout/silencing strategies:

      • CRISPR-Cas9 editing of the viral genome (if technically feasible)

      • siRNA-mediated silencing with multiple target sequences

      • Antisense oligonucleotide approaches

      • Dominant negative mutant expression

    2. Experimental design principles:

      • Include appropriate controls (non-targeting siRNA, essential gene targeting, non-essential gene targeting)

      • Use multiple MOIs to detect subtle phenotypes

      • Collect data at multiple time points to identify delayed rather than blocked replication

      • Perform technical and biological replicates with statistical analysis

    3. Phenotypic assessment metrics:

      MeasurementMethodologyInterpretation for Essentiality
      Viral titerPlaque assay/TCID50Significant reduction suggests essential function
      Viral DNA replicationqPCREarly reduction indicates role in replication
      Viral factory formationFluorescence microscopyAbnormal factories suggest structural role
      Virion morphologyElectron microscopyDefects indicate role in assembly
      Viral protein synthesisProteomics/Western blotAltered expression patterns suggest regulatory role
    4. Rescue experiments:

      • Complementation with wild-type MIMI_R571

      • Domain mutant complementation to identify critical regions

      • Complementation timing to determine stage-specific requirements

    5. Comparative analysis:

      • Evaluate differences across mimivirus strains with natural variations in R571

      • Assess evolutionary conservation patterns

    Recent research using gene knockout approaches in mimivirus demonstrated that the MC1-like DNA architectural protein (gp275) is essential for viral multiplication , providing a methodological framework for similar studies with MIMI_R571.

  • How can computational evolutionary analysis help understand the origin and function of MIMI_R571?

    Computational evolutionary analysis provides crucial insights into MIMI_R571's origin, conservation, and potential function through multiple methodological approaches:

    1. Homology detection beyond standard methods:

      • Position-Specific Iterative BLAST (PSI-BLAST) for distant homologs

      • Hidden Markov Model (HMM) profiles using HMMER

      • Profile-profile comparisons using HHpred

      • Structure-based homology detection using protein threading

    2. Evolutionary rate analysis:

      • dN/dS ratio calculation to detect selective pressure

      • Relative evolutionary rate compared to core viral genes

      • Codon usage analysis for evidence of horizontal gene transfer

      • Identification of conserved motifs using MEME or GLAM2

    3. Phylogenetic analysis methodologies:

      • Maximum likelihood tree construction with bootstrapping

      • Bayesian inference for confidence assessment

      • Reconciliation of gene and species trees to detect lateral gene transfer

      • Synteny analysis across viral genomes

    4. Ancestral sequence reconstruction:

      • Infer ancestral states at internal tree nodes

      • Identify key mutations that shaped current function

      • Test reconstructed ancestral proteins experimentally

    5. Specific applications to MIMI_R571:

      • Determine if it represents a viral innovation or acquisition from cellular organisms

      • Identify potential functional shifts through evolutionary history

      • Predict functional residues based on conservation patterns

      • Understand context in viral genome architecture

    This approach has yielded valuable insights for other mimivirus proteins; for example, phylogenetic analysis of the MC1-like protein (gp275) revealed potential acquisition from archaeal sources, with subsequent divergence and specialization for viral genome packaging .

Research Application Questions

  • How can recombinant MIMI_R571 be used as a tool for studying mimivirus-host interactions?

    Recombinant MIMI_R571 offers multiple applications for investigating mimivirus-host interactions:

    1. Host protein interaction studies:

      • Affinity purification using tagged MIMI_R571 to identify host binding partners

      • Surface plasmon resonance to measure binding kinetics with candidate partners

      • In situ proximity labeling to identify interaction networks in cellular context

      • Yeast two-hybrid screening against host protein libraries

    2. Cellular localization investigations:

      • Immunofluorescence using anti-MIMI_R571 antibodies in infected cells

      • Subcellular fractionation followed by Western blotting

      • Live-cell imaging with fluorescently tagged protein (if functional)

      • Co-localization with host organelle markers

    3. Host response analysis:

      • Transcriptomics of host cells exposed to purified MIMI_R571

      • Phosphoproteomics to detect signaling pathway activation

      • Cytokine profiling to assess inflammatory responses

      • Host protein turnover analysis using pulse-chase methods

    4. Functional interference studies:

      • Competition assays with exogenous MIMI_R571 during infection

      • Dominant negative variants to disrupt endogenous function

      • Pre-binding of host targets to block viral MIMI_R571 interactions

      • Antibody-mediated neutralization of extracellular function

    Recent studies with other mimivirus proteins have revealed significant host transcriptome remodeling during infection, including downregulation of cytoskeleton-related genes and upregulation of peroxisome and ubiquitin-proteasome system genes , providing a framework for investigating MIMI_R571's potential role in these processes.

  • What are the key considerations for designing enzyme activity assays for potential MIMI_R571 esterase function?

    Designing robust enzyme activity assays for MIMI_R571, classified under EC 3.1.1.- (esterase), requires systematic methodology:

    1. Substrate selection strategy:

      • Begin with promiscuous esterase substrates (p-nitrophenyl esters with varying acyl chain lengths)

      • Test physiologically relevant substrates based on viral replication needs

      • Include lipid-based substrates (phospholipids, lysophospholipids)

      • Create substrate panels for specificity profiling

    2. Assay method options:

      Assay TypePrincipleAdvantagesLimitations
      SpectrophotometricRelease of chromogenic leaving groupSimple, continuous, high-throughputLimited substrate options
      FluorometricFluorescent product generationHigher sensitivity, lower sample requirementPotential interference from protein fluorescence
      RadiometricRadiolabeled substrate conversionHighest sensitivity, natural substratesSpecialized facilities, discontinuous
      pH-statProton release during hydrolysisDirect measurement, natural substratesLower throughput, specialized equipment
    3. Reaction condition optimization:

      • pH optimization (typically pH 6.0-9.0 for esterases)

      • Buffer composition screening

      • Metal ion dependence analysis

      • Temperature dependence profiling

      • Detergent effects assessment

    4. Kinetic parameter determination:

      • Michaelis-Menten kinetics (Km, Vmax, kcat)

      • Substrate specificity constants (kcat/Km)

      • Inhibition studies

      • Cooperativity analysis if applicable

    5. Controls and validation:

      • Heat-inactivated enzyme negative control

      • Known esterase positive control

      • Site-directed mutants of predicted catalytic residues

      • Mass spectrometry verification of reaction products

    This methodical approach will determine whether MIMI_R571 possesses the predicted esterase activity and establish its substrate preference and catalytic efficiency.

  • How does the study of uncharacterized proteins like MIMI_R571 contribute to viral taxonomy and classification efforts?

    The study of uncharacterized proteins like MIMI_R571 significantly influences viral taxonomy and classification through several methodological approaches:

    1. Comparative genomics framework:

      • Presence/absence patterns across viral families

      • Conservation level as indicator of evolutionary history

      • Synteny analysis to establish genomic context

      • Identification of signature proteins for taxonomic assignment

    2. Phylogenomic applications:

      • Concatenated protein alignments for robust phylogenetic trees

      • Gene content-based clustering

      • Protein domain architecture as taxonomic marker

      • Shared gene network analysis

    3. Functional innovation tracing:

      • Identification of family-specific functional adaptations

      • Recognition of horizontal gene transfer events

      • Documentation of gene fusion/fission events

      • Annotation of lineage-specific expansions

    The comparison of complete mimivirus genomes has revealed distinct lineages (A, B, and C) with shared core genes and lineage-specific genes . Studying uncharacterized proteins like MIMI_R571 helps determine:

    • Whether they represent core mimivirus genes or lineage-specific innovations

    • If they originated through horizontal gene transfer or de novo emergence

    • Their relationship to proteins in other NCLDV families

    • Their potential as taxonomic markers for classification

    The Mamavirus, a relative of the original mimivirus with a slightly larger genome (1,191,693 bp compared to 1,181,404 bp), contains most of the same genes as APMV with high sequence similarity . Detailed analysis of proteins like MIMI_R571 across mimivirus strains helps establish the evolutionary relationships and classification boundaries within the expanding world of giant viruses.

  • What approaches can integrate structural, functional, and evolutionary data to develop a comprehensive understanding of MIMI_R571?

    An integrated multi-omics approach to fully characterize MIMI_R571 would include:

    1. Data generation across multiple domains:

      • Structural determination: X-ray crystallography, cryo-EM, or AlphaFold2 prediction

      • Functional assays: Biochemical characterization, cellular effects, interaction mapping

      • Evolutionary analysis: Phylogenetics, selective pressure analysis, ancestral reconstruction

      • Expression profiling: Transcriptomics and proteomics during infection

    2. Integration methodology:

      • Structure-function mapping: Identifying functional motifs within the 3D structure

      • Evolutionary conservation visualization on structural models

      • Network analysis incorporating protein interactions and co-expression data

      • Machine learning approaches to predict function from combined datasets

    3. Computational frameworks for integration:

      • Cytoscape for network visualization and analysis

      • PyMOL or UCSF Chimera for structure-based analysis

      • Dedicated multi-omics platforms like Perseus or Qiagen IPA

      • Custom R or Python scripts for specialized analyses

    4. Validation through targeted experiments:

      • Structure-guided mutagenesis of predicted functional residues

      • In vivo verification of computationally predicted functions

      • Testing evolutionary hypotheses through ancestral protein reconstruction

    Recent advances in protein function prediction demonstrate that integrating structure and sequence data through graph convolutional networks significantly outperforms sequence-only approaches . This highlights the importance of structural information in understanding proteins like MIMI_R571.

    For mimivirus proteins, integration of structural information with evolutionary data has been particularly valuable, as demonstrated by the characterization of the MC1-like DNA architectural protein (gp275), where structural features predicted by AlphaFold2 were essential for understanding its function in DNA condensation .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.