Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein R660 (MIMI_R660)

Shipped with Ice Packs
In Stock

Description

Introduction

Acanthamoeba polyphaga Mimivirus (APMV) is a giant virus known to infect amoeba and has a large double-stranded DNA genome encoding nearly 1,000 proteins . Among these proteins is the uncharacterized protein R660 (MIMI_R660), a protein of unknown function within the virus .

General Information

Cat.No.RFL21723AF
Product OverviewRecombinant Full Length Acanthamoeba polyphaga mimivirus Uncharacterized protein R660(MIMI_R660) Protein (Q5UR15) (1-206aa), fused to N-terminal His tag, was expressed in E. coli .
SpeciesAPMV
SourceE. coli
TagHis
Protein LengthFull Length (1-206)
FormLyophilized powder
AA SequenceMNKDTDNVEVNIVYKNRTISVPINITMSICALTALLKSYSITGSYHGYNHNYEYHHYHGYNHYNGYNYGKNNKGKIRVGVVSDHKPPFVLTKFPNEMLLLNFRIKEGDRFYVIFEDDYGIPNTHAHDIHESYKQYEPYEPYKSQKNIYIKTLKRAIIADNHRMVEYILDKELVDLHSNKKL YEKCIKLSKIHSRTYIQNLLEVVAL
PurityGreater than 90% as determined by SDS-PAGE .
NotesRepeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week .
StorageStore at -20°C/-80°C upon receipt, aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles .
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
ReconstitutionWe recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference .
Gene NameMIMI_R660
SynonymsMIMI_R660; Uncharacterized protein R660
UniProt IDQ5UR15

Function and Significance

As the name suggests, MIMI_R660 is currently an uncharacterized protein . Functional characterization of such proteins can provide insights into the unique biology and mechanisms employed by Mimiviruses . Identifying the roles of uncharacterized proteins like MIMI_R660 may help in understanding viral replication strategies, host-virus interactions, and potential therapeutic targets .

Recombinant Production

Recombinant MIMI_R660 protein is produced in E. coli with an N-terminal His tag to facilitate purification . The protein consists of 206 amino acids . Recombinant proteins are valuable for research because they allow for detailed in vitro studies, structural analysis, and the development of assays to understand protein function .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
MIMI_R660; Uncharacterized protein R660
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-206
Protein Length
full length protein
Species
Acanthamoeba polyphaga mimivirus (APMV)
Target Names
MIMI_R660
Target Protein Sequence
MNKDTDNVEVNIVYKNRTISVPINITMSICALTALLKSYSITGSYHGYNHNYEYHHYHGY NHYNGYNYGKNNKGKIRVGVVSDHKPPFVLTKFPNEMLLLNFRIKEGDRFYVIFEDDYGI PNTHAHDIHESYKQYEPYEPYKSQKNIYIKTLKRAIIADNHRMVEYILDKELVDLHSNKK LYEKCIKLSKIHSRTYIQNLLEVVAL
Uniprot No.

Target Background

Database Links

KEGG: vg:9925305

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is the genomic context of the uncharacterized protein R660 in mimivirus?

The uncharacterized protein R660 (MIMI_R660) is encoded within the 1.2 Mb dsDNA genome of Acanthamoeba polyphaga mimivirus. Like other mimiviral proteins, it exists within a genomic context that is organized into a sophisticated structure. Recent cryo-electron microscopy and tomography studies have revealed that the mimivirus genome is encased in a ~30 nm diameter helical protein shell, forming what researchers describe as a genomic fiber . Understanding this genomic organization is critical as it suggests that R660, like other mimivirus proteins, may play specialized roles within the complex architecture of this giant virus. For initial characterization, researchers should consider R660's position within the genome and its potential interactions with nearby genes to develop hypotheses about its function.

What expression systems are most effective for recombinant production of mimivirus proteins like R660?

Based on established methodologies for mimiviral proteins, bacterial expression systems using pET vectors have proven effective for recombinant protein production. For example, the pET16b vector was successfully employed for expressing the L230 protein of mimivirus . When working with R660, researchers should consider:

  • Codon optimization for the selected expression system

  • Selection of appropriate fusion tags (His, GST, or MBP) to improve solubility

  • Varying induction conditions (temperature, IPTG concentration, and duration)

  • Testing multiple expression hosts (E. coli strains BL21(DE3), Rosetta, or Arctic Express)

  • Implementing solubility enhancement strategies such as co-expression with chaperones

Eukaryotic expression systems, including insect cells using baculovirus vectors, may also be valuable alternatives if bacterial expression yields insoluble protein, particularly given the potential complexity of viral proteins.

What bioinformatic approaches can help predict potential functions of R660?

A multi-faceted bioinformatic approach should be employed for uncharacterized proteins like R660:

  • Sequence homology analysis: Utilize BLAST, PSI-BLAST, and HHpred to identify distant homologs across viral and cellular organisms

  • Protein domain prediction: Employ InterProScan similar to the approach used to identify the putative MC1 domain in mimivirus gp275

  • Secondary structure prediction: Tools like PSIPRED, JPred, and SOPMA can identify structural elements

  • Disorder prediction: PONDR, IUPred for identifying intrinsically unstructured regions

  • Subcellular localization prediction: NLStradamus, NetNES for nuclear localization/export signals

  • Functional motif identification: ScanProsite, ELM for recognizing short functional motifs

These computational analyses should be conducted prior to experimental work to guide hypothesis formation and experimental design.

How can one determine if R660 undergoes post-translational modifications similar to other mimivirus proteins?

Mimivirus proteins are known to undergo specialized post-translational modifications, as evidenced by the L230-mediated hydroxylation and glycosylation of collagen-like proteins . To investigate potential modifications of R660:

  • Mass spectrometry analysis:

    • Express R660 recombinantly in systems that mimic native conditions

    • Perform alkaline hydrolysis as used for detecting hydroxylysine in mimivirus proteins

    • Employ Dionex AAA-Direct amino acid analysis with pulsed amperometric detection

    • Collect fractions for targeted MS/MS analysis

  • Specific modification analysis:

    • Phosphorylation: ProQ Diamond staining and phospho-specific antibodies

    • Glycosylation: Periodic acid-Schiff staining, lectin binding assays

    • Hydroxylation: Amino acid analysis specifically targeting hydroxylated residues

  • Comparative analysis:

    • Express R660 in both infected amoeba and heterologous systems

    • Compare modification patterns to identify host-dependent modifications

These methods can reveal if R660 undergoes modifications that might be essential for its structural integrity or functional activity.

What experimental approaches can determine R660's expression timing during mimivirus infection?

Understanding R660's temporal expression pattern is crucial for functional characterization. Based on established protocols for mimivirus gene expression studies:

  • Northern blot analysis:

    • Design R660-specific probes

    • Extract RNA from infected A. polyphaga at various time points

    • Compare expression pattern with known early, intermediate, and late genes

    • Similar to the approach used for tracking L230 expression alongside collagen genes

  • RT-qPCR analysis:

    • Develop specific primers for R660

    • Establish a time course experiment (0-24h post-infection)

    • Normalize against known reference genes

    • Classify as early, intermediate, or late gene based on expression kinetics

  • Protein detection:

    • Generate antibodies against recombinant R660

    • Perform western blot analysis of infected culture lysates

    • Use R252 (gp275) expression pattern as reference, which shows intermediate to late expression

  • Fluorescent tagging approach:

    • Similar to the strategy with gp275-EGFP and gp455-RFP

    • Generate recombinant mimivirus with fluorescently-tagged R660

    • Track protein appearance and localization during infection cycle

How might R660 relate to the genomic fiber structure of mimivirus?

Recent studies have revealed that the mimivirus genome is organized as a genomic fiber approximately 30 nm in width . To investigate R660's potential role in this structure:

  • Immunolocalization studies:

    • Generate R660-specific antibodies

    • Perform immunogold labeling of purified genomic fibers

    • Analyze using electron microscopy to detect association with the fiber

  • Biochemical fractionation:

    • Isolate genomic fibers using limited proteolysis protocols

    • Analyze protein composition by mass spectrometry

    • Quantify R660 abundance in fiber fractions versus whole virion

  • In vitro binding assays:

    • Express recombinant R660

    • Test DNA binding capacity using electrophoretic mobility shift assays

    • Compare with characterized DNA architectural proteins like gp275

  • Pull-down experiments:

    • Use tagged R660 as bait

    • Identify interacting proteins from viral lysates

    • Focus on known components of the genomic fiber structure

What strategies can overcome challenges in generating R660 deletion or knockout mutants?

Creating genetic modifications in large DNA viruses presents significant challenges. Based on successful approaches with other mimivirus genes:

  • Homologous recombination strategy:

    • Design constructs with selection markers flanked by R660 homologous regions

    • Similar to the approach used for generating fluorescent protein fusions with R252

    • Optimize transfection conditions for amoeba hosts

    • Screen recombinants using PCR and sequencing

  • Complementation systems:

    • If R660 is essential (like gp275 ), develop complementation strategies

    • Create cell lines expressing R660 to support growth of deletion mutants

    • Design conditional expression systems to study phenotypic effects

  • CRISPR-Cas9 adaptation:

    • Optimize delivery of guide RNAs and Cas9 into amoeba hosts

    • Target R660 coding sequence at multiple sites

    • Develop screening methods for large viral genomes

  • Alternative approaches:

    • Dominant negative mutants of R660

    • Antisense RNA or morpholino oligonucleotides

    • Small molecule inhibitors if protein function can be predicted

For each approach, careful consideration of mimivirus replication kinetics and host cell biology is essential for successful genetic manipulation.

How can structural biology techniques be applied to determine R660's three-dimensional structure?

Determining the structure of viral proteins provides crucial insights into function. For R660:

  • X-ray crystallography pipeline:

    • Optimize expression and purification for high protein yield

    • Employ thermal shift assays to identify stabilizing buffer conditions

    • Utilize limited proteolysis to identify stable domains

    • Screen crystallization conditions extensively

    • Consider fusion with crystallization chaperones

  • Cryo-electron microscopy:

    • Particularly valuable if R660 forms oligomeric structures

    • Similar to approaches used for visualizing mimivirus genomic fibers

    • Optimize sample preparation to avoid aggregation

    • Consider GraFix method for stabilizing complexes

  • NMR spectroscopy:

    • Suitable for smaller domains of R660

    • Requires isotopic labeling (15N, 13C)

    • Provides dynamic information not accessible by other methods

  • Integrative structural biology:

    • Combine multiple low-resolution techniques

    • Incorporate small-angle X-ray scattering (SAXS)

    • Use crosslinking mass spectrometry to constrain models

    • Validate with hydrogen-deuterium exchange mass spectrometry

What protein-protein interaction networks might include R660, and how can they be mapped?

Understanding the interactome of R660 can provide functional insights:

  • Affinity purification-mass spectrometry:

    • Express tagged R660 in mimivirus-infected amoeba

    • Perform pulldowns at different infection stages

    • Identify interaction partners by mass spectrometry

    • Compare with interaction networks of characterized proteins like gp275

  • Proximity labeling approaches:

    • Fuse R660 with BioID or APEX2

    • Allow in vivo biotinylation of proximal proteins

    • Purify biotinylated proteins and identify by MS

    • Create spatial interaction maps within the viral factory

  • Yeast two-hybrid screening:

    • Use R660 as bait against a mimivirus protein library

    • Validate interactions using co-immunoprecipitation

    • Map interaction domains through deletion constructs

  • Fluorescence microscopy:

    • Perform co-localization studies with known viral proteins

    • Implement Förster resonance energy transfer (FRET) for direct interaction detection

    • Use fluorescence correlation spectroscopy for dynamic interactions

MethodAdvantagesLimitationsAppropriate Use Case
AP-MSIdentifies complexes in near-native conditionsMay lose transient interactionsStable protein complexes
Proximity labelingCaptures transient interactionsNon-specific labelingDynamic interaction networks
Y2HHigh-throughputHigh false positive rateInitial interaction screening
FRETDirect interaction evidenceRequires fluorescent taggingValidation of specific interactions

What is the potential role of R660 in DNA packaging and genome organization?

Given the sophisticated genome packaging of mimivirus into a 30 nm fiber structure , R660 might participate in genome organization:

  • DNA binding characterization:

    • Express recombinant R660 and purify to homogeneity

    • Perform electrophoretic mobility shift assays with viral DNA fragments

    • Test sequence specificity using competitive binding assays

    • Compare with the DNA-bending properties of gp275

  • Chromatin immunoprecipitation sequencing (ChIP-seq):

    • Generate antibodies against R660 or use epitope-tagged protein

    • Perform ChIP-seq from infected cells at various time points

    • Map binding sites across the mimivirus genome

    • Identify DNA sequence or structural motifs at binding sites

  • In vitro DNA packaging assays:

    • Reconstitute minimal DNA packaging systems with purified components

    • Test R660's ability to compact DNA similar to gp275

    • Visualize DNA-protein complexes using atomic force microscopy

    • Measure effects on DNA topology using supercoiling assays

  • Single-molecule approaches:

    • Use optical or magnetic tweezers to study R660-DNA interactions

    • Measure forces involved in DNA compaction

    • Observe real-time binding and architectural changes

    • Compare with characterized architectural proteins like MC1-like domain proteins

What purification strategies are optimal for obtaining active R660 protein?

Purification of mimivirus proteins requires specialized approaches:

  • Solubility optimization:

    • Test multiple fusion tags (His, GST, MBP, SUMO)

    • Optimize lysis buffer conditions (salt concentration, pH, detergents)

    • Evaluate different extraction methods (sonication, French press, freeze-thaw)

    • Consider native purification from infected amoeba for comparison

  • Chromatography pipeline:

    • Begin with affinity chromatography based on fusion tag

    • Implement ion exchange chromatography as secondary step

    • Refine with size exclusion chromatography

    • Consider hydroxyapatite chromatography for DNA-binding proteins

  • Quality control:

    • Assess purity by SDS-PAGE and mass spectrometry

    • Verify folding using circular dichroism spectroscopy

    • Evaluate oligomeric state by analytical ultracentrifugation

    • Test activity using appropriate functional assays

  • Stabilization strategies:

    • Screen buffer additives using thermal shift assays

    • Identify optimal storage conditions

    • Consider protein engineering to improve stability

    • Evaluate the need for binding partners for stability

How can functional genomics approaches be applied to understand R660's role in mimivirus biology?

Comprehensive functional genomics strategies can illuminate R660's biological significance:

  • Transcriptome analysis:

    • Perform RNA-seq of mimivirus-infected amoeba with and without R660 modification

    • Identify genes with altered expression profiles

    • Construct gene regulatory networks

    • Compare with expression patterns of known DNA architectural proteins

  • Proteome analysis:

    • Quantitative proteomics of virions with altered R660 expression

    • Analysis of post-translational modifications as observed for other mimivirus proteins

    • Protein turnover studies using pulse-chase labeling

    • Correlation of protein levels with functional outcomes

  • Genetic interaction mapping:

    • Develop double mutant libraries if feasible

    • Screen for synthetic lethality or suppression

    • Map genetic pathways involving R660

    • Connect to known functional modules in mimivirus

  • Evolutionary analysis:

    • Compare R660 across mimivirus lineages

    • Identify conserved domains and variable regions

    • Reconstruct evolutionary history

    • Correlate with host range and virulence

What imaging techniques can visualize R660 during the mimivirus replication cycle?

Advanced microscopy approaches can track R660 within the complex viral factory:

  • Fluorescence microscopy:

    • Generate fluorescently tagged R660 through homologous recombination

    • Apply the approach used for gp275-EGFP visualization

    • Track localization throughout infection (6-8h post-infection)

    • Co-localize with viral factory markers and DNA staining

  • Super-resolution microscopy:

    • Implement STED, PALM, or STORM for nanoscale resolution

    • Visualize R660 distribution within the viral factory

    • Resolve potential architectural structures

    • Track dynamic changes during infection progression

  • Correlative light and electron microscopy (CLEM):

    • Combine fluorescence imaging with electron microscopy

    • Precisely localize R660 relative to viral ultrastructure

    • Connect to genomic fiber structures observed by cryo-EM

    • Develop 3D reconstructions of R660 within the viral assembly

  • Live-cell imaging:

    • Track R660 dynamics in real-time during infection

    • Measure protein turnover using photobleaching techniques

    • Quantify mobility and diffusion characteristics

    • Correlate with key events in viral replication

How might R660 contribute to mimivirus host range determination?

Understanding host-pathogen interactions involving R660:

  • Host factor identification:

    • Perform yeast two-hybrid or AP-MS against host proteome

    • Screen multiple potential host species for differential interactions

    • Identify host proteins that interact specifically with R660

    • Validate interactions in the context of infection

  • Comparative analysis across amoebal hosts:

    • Test infection efficiency in multiple Acanthamoeba species

    • Compare R660 sequence conservation with host tropism

    • Identify host factors that influence R660 function

    • Develop experimental systems to test host specificity determinants

  • CRISPR screens in host cells:

    • Develop CRISPR libraries for amoeba hosts

    • Screen for host factors that modulate R660 function

    • Identify genetic pathways involved in restriction or dependence

    • Connect to broader host defense mechanisms

What computational models could predict R660's role in the mimivirus genomic architecture?

Advanced computational approaches can generate testable hypotheses:

  • Molecular dynamics simulations:

    • Model R660 structure based on homology or de novo prediction

    • Simulate interactions with DNA and other viral proteins

    • Predict conformational changes during DNA binding

    • Compare with characterized architectural proteins like gp275

  • Network analysis:

    • Construct protein-protein interaction networks from experimental data

    • Identify network motifs and modules involving R660

    • Predict functional relationships based on network topology

    • Connect to known pathways in viral replication

  • Machine learning approaches:

    • Train models on known viral architectural proteins

    • Predict functional characteristics of R660

    • Identify potential binding sites and interaction partners

    • Generate hypotheses for experimental validation

  • Evolutionary coupling analysis:

    • Identify co-evolving residues within R660

    • Predict structural contacts and functional domains

    • Map conservation patterns to functional constraints

    • Guide mutagenesis studies for functional characterization

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.