Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein R694 (MIMI_R694)

Shipped with Ice Packs
In Stock

Description

Functional Insights and Pathway Involvement

While direct functional studies on MIMI_R694 are absent, its genomic context within APMV provides indirect clues:

Genomic Context and Hypothetical Roles

APMV encodes over 1,000 proteins, many of which remain uncharacterized. Proteins like R694 may participate in:

  • Viral Replication: APMV replicates in host cytoplasmic "factories," involving genome packaging and capsid assembly .

  • Host Interaction: APMV encodes proteins for host immune evasion, nutrient acquisition, and membrane remodeling .

  • Stress Response: Mimivirus genomes include enzymes for DNA repair and oxidative stress mitigation .

Comparative Analysis with Other Mimivirus Proteins

ProteinFunctionShared Features with R694
R135Fiber formation, oxidative pathways Both expressed early in infection
L829Virion assembly, genomic stability Uncharacterized until functional studies
NDKNucleoside diphosphate kinase ATPase activity (hypothetical)

Experimental Utility

MIMI_R694 is commercially available for:

  • Antibody Production: ELISA assays for serological studies .

  • Structural Studies: Crystallization and X-ray/NMR analysis to resolve tertiary structure.

  • Functional Screens: Yeast two-hybrid or co-IP studies to identify interactors.

Unresolved Challenges

  1. Functional Elucidation: No homologs in public databases limit bioinformatics-based predictions.

  2. Pathway Mapping: No reported interactions or pathway associations (e.g., replication, transcription) .

  3. Host Interaction: Unknown role in APMV infection or host cell modulation.

Future Directions

MIMI_R694 represents a high-priority target for functional genomics in mimivirus research. Priorities include:

  1. Cryo-EM/X-ray Crystallography: Resolving structural motifs for functional inference.

  2. RNAi Knockdown: Testing phenotypic effects in Acanthamoeba infection models .

  3. Proteomic Interactomes: Identifying binding partners via mass spectrometry.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Shipping is standard with blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MIMI_R694; Uncharacterized protein R694
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-111
Protein Length
full length protein
Species
Acanthamoeba polyphaga mimivirus (APMV)
Target Names
MIMI_R694
Target Protein Sequence
MSHFSRCFDECSKIERPNVNKKLTRLIIVLFCLLCIIVTLGVIGYKFLFKMSYVDAIYNT AITTSTLGIAPGDKTDAEKIFTGIYAVLVGVFFISVISAIVSYMFTTYILD
Uniprot No.

Target Background

Database Links

KEGG: vg:9925346

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is known about the uncharacterized protein R694 in Mimivirus?

R694 is one of many uncharacterized proteins in the Mimivirus genome. Like more than half of the putative genes in giant viruses such as Mimivirus, R694 is considered an ORFan (open reading frame with no known function) . The protein remains largely uncharacterized, though methodologies used to study other mimivirus proteins can be applied to investigate its function. Research approaches including RNA interference, comparative proteomics, and immunodetection techniques have proven effective for characterizing other previously unknown mimivirus proteins .

What techniques are most effective for preliminary characterization of uncharacterized Mimivirus proteins?

For initial characterization of uncharacterized proteins like R694, RNA interference (RNAi) using short interfering RNAs (siRNAs) has proven highly effective. This approach allows for the selective silencing of specific genes to observe resulting phenotypic changes . Additional preliminary techniques include comparative proteomics using two-dimensional difference-in-gel electrophoresis (2D-DIGE) to identify expression changes , and immunodetection with specific antibodies to observe protein localization and expression patterns during viral infection cycles . These methods have successfully characterized other mimivirus proteins and could be applied to R694 characterization.

How are gene silencing experiments designed for Mimivirus proteins?

Gene silencing experiments for Mimivirus proteins involve designing specific siRNAs targeting the gene of interest, transfecting these into host amoeba cells (A. polyphaga) infected with Mimivirus, and then assessing the effects on viral fitness and protein expression. For example, when studying the R458 protein, researchers confirmed successful transfection by detecting fluorescence inside amoeba at 3 hours post-infection and validated gene silencing by measuring mRNA levels using RT-PCR at 6 hours post-infection . This approach demonstrated significant reduction in target gene expression and can be adapted for studying R694.

How can one determine if the uncharacterized protein R694 is essential for Mimivirus replication?

To determine if R694 is essential for Mimivirus replication, researchers should implement a multi-phase approach. First, silence the R694 gene using siRNA and quantify viral particle production at different time points during infection. As demonstrated in studies of the R458 protein, immunodetection and quantitative PCR can be used to measure the impact on viral factory formation and final viral particle production . It's important to monitor both the growth rate and the final viral output, as some proteins may affect replication kinetics without changing the final viral yield. For example, when R458 was silenced, researchers observed delayed entry into the eclipse phase and reduced virus factory formation, but the final concentration of viral particles remained unchanged .

What proteomics approaches are most informative for characterizing the function of uncharacterized Mimivirus proteins?

The most informative proteomics approach for characterizing uncharacterized Mimivirus proteins combines comparative 2D-DIGE with mass spectrometry identification techniques. When studying silenced versus wild-type viruses, this approach can reveal which proteins are up- or down-regulated as a consequence of silencing the target gene . For R458, this approach identified 83 deregulated peptide spots (48 downregulated and 35 upregulated) . A similar analysis for R694 would potentially reveal its position in protein interaction networks and suggest functional pathways. Additional techniques to consider include immunoprecipitation followed by mass spectrometry to identify interaction partners, and targeted proteomic analysis focusing on post-translational modifications.

How can one integrate structural analysis with functional studies for uncharacterized Mimivirus proteins?

Integrating structural and functional analyses for uncharacterized proteins like R694 requires a comprehensive approach. Begin with in silico structural prediction using tools that identify potential structural domains, followed by experimental validation through techniques like X-ray crystallography or cryo-electron microscopy. Then correlate structural features with functional data obtained from gene silencing experiments. Proteins with similar structural features to R694 might suggest functional similarities. Additionally, site-directed mutagenesis targeting predicted functional domains can help establish structure-function relationships. This integrated approach has successfully characterized other viral proteins and could be applied to R694 to elucidate its role within the Mimivirus life cycle.

What controls should be included when using RNAi to characterize R694 function?

When designing RNAi experiments to characterize R694 function, several essential controls must be included:

  • Negative controls:

    • Untreated Mimivirus (no siRNA)

    • Mimivirus treated with non-targeting siRNA

    • Mimivirus treated with siRNA targeting a known non-essential gene

  • Positive controls:

    • siRNA targeting a known essential gene with predictable phenotype

    • siRNA targeting a gene with known function (e.g., a capsid protein like L425)

  • Validation controls:

    • RT-PCR to confirm reduction in target mRNA levels

    • Western blot to confirm reduction in target protein levels

These controls were successfully implemented in studies of other Mimivirus proteins, such as when researchers targeted the L425 gene (encoding the major capsid protein) as a control to ensure there were no non-specific effects of siRNAs on fibers .

How should experiments be designed to determine the subcellular localization of R694?

To determine the subcellular localization of R694, implement the following experimental design:

TechniqueApplicationExpected Outcome
Immunogold electron microscopyDirect visualization of protein locationGold particles indicate R694 location within viral particle or infected cell
Confocal microscopy with fluorescent antibodiesVisualization in intact cellsFluorescence pattern reveals distribution during infection cycle
Subcellular fractionationBiochemical separation of cellular componentsWestern blot detection of R694 in specific fractions
Mass spectrometry of purified viral componentsProteomic analysis of specific structuresPresence/absence of R694 in viral structures

This multi-method approach has been effective for other Mimivirus proteins. For example, fiber-associated proteins were confirmed using immunogold electron microscopy with anti-fiber antibodies, revealing their precise localization . Similar techniques could determine whether R694 is associated with specific viral structures or distributed throughout the viral particle.

What is the optimal timeline for studying R694 expression during the Mimivirus replication cycle?

Based on studies of other Mimivirus proteins, the optimal timeline for studying R694 expression should cover key stages of the viral replication cycle:

  • Early phase (0-4 hours post-infection): Initial virus-host interactions and early gene expression

  • Mid phase (4-8 hours post-infection): Viral factory formation and DNA replication

  • Late phase (8-16 hours post-infection): Virion assembly

  • Very late phase (16-24 hours post-infection): Virus maturation and release

Sampling should be particularly focused around hours 4, 7, 9, and 12 post-infection, as these time points have revealed significant differences in virus factory formation when studying other proteins . For R458, researchers quantified virus factories at 7, 9, and 12 hours post-infection, observing significantly different numbers between wild-type and silenced virus . This timeline would likely reveal critical periods for R694 function during the viral life cycle.

How can one distinguish direct versus indirect effects when analyzing results from R694 silencing experiments?

Distinguishing direct from indirect effects in R694 silencing experiments requires a multi-faceted analytical approach:

  • Temporal analysis: Monitor the sequence of events following gene silencing. Direct effects typically manifest earlier than indirect effects.

  • Dose-response relationship: Test varying levels of gene silencing to observe whether effects scale proportionally with silencing efficiency.

  • Rescue experiments: Attempt to rescue the silenced phenotype by expressing an siRNA-resistant version of R694.

  • Protein interaction studies: Identify direct binding partners of R694 through techniques like co-immunoprecipitation.

  • Comparative proteomics: As demonstrated with R458, use 2D-DIGE to identify all deregulated proteins following silencing and categorize them based on known functional relationships .

This comprehensive approach helps distinguish primary effects directly caused by R694 silencing from secondary consequences that ripple through the viral replication system.

What statistical approaches are most appropriate for analyzing proteomics data from R694 functional studies?

When analyzing proteomics data from R694 functional studies, implement the following statistical approaches:

  • Differential expression analysis: Use statistical tests adjusted for multiple comparisons (e.g., FDR-corrected t-tests) to identify significantly up- or down-regulated proteins.

  • Cluster analysis: Group proteins with similar expression patterns to identify co-regulated networks.

  • Pathway enrichment analysis: Determine whether deregulated proteins belong to specific functional pathways.

  • Time-series analysis: For temporal proteomics data, use time-series statistical methods to identify proteins with significant expression changes over time.

  • Machine learning approaches: Implement supervised learning algorithms to identify protein signatures associated with specific phenotypic changes.

These approaches have successfully identified deregulated proteins in other Mimivirus studies, such as the identification of 83 deregulated peptide spots following R458 silencing .

How should contradictory results be addressed when studying R694 function?

When faced with contradictory results in R694 function studies, implement the following resolution strategy:

  • Methodological validation: Verify all experimental protocols through replication and validate key reagents (antibodies, siRNAs) for specificity.

  • Context dependency analysis: Determine whether contradictions arise from differences in experimental conditions, viral strains, or host cell states.

  • Temporal considerations: Assess whether contradictions reflect different stages of the viral life cycle rather than true contradictions.

  • Measurement technique comparison: Compare results obtained through different measurement techniques (e.g., RNA-seq vs. proteomics vs. phenotypic assays).

  • Integration of multiple data types: Create an integrated model that accommodates seemingly contradictory observations within a broader functional framework.

This approach mirrors successful resolution strategies used in other Mimivirus protein studies, where initial contradictions between growth kinetics and final viral output revealed nuanced protein functions .

What CRISPR-based approaches could be adapted for studying R694 function?

While CRISPR-Cas systems are primarily designed for editing cellular genomes rather than viral genomes, modified approaches could be developed for studying R694:

  • Host-directed CRISPR: Target host factors that interact with R694 to indirectly study its function.

  • CRISPR interference (CRISPRi): Adapt dCas9-based transcriptional repression systems for viral gene silencing as an alternative to RNAi.

  • CRISPR screening: Implement genome-wide CRISPR screens in host cells to identify factors essential for R694 function.

  • Viral genome editing: Develop specialized techniques for direct editing of the mimivirus genome to introduce mutations or deletions in the R694 gene.

These approaches would complement traditional RNAi-based silencing methods, which have proven effective for studying other mimivirus proteins .

How can next-generation sequencing technologies be leveraged to study R694 function?

Next-generation sequencing technologies offer powerful approaches for studying R694 function:

Sequencing ApproachApplication for R694 ResearchAnticipated Insights
RNA-seqTranscriptome-wide effects of R694 silencingGenes regulated directly or indirectly by R694
Ribo-seqTranslational impact of R694 silencingR694's role in viral translation regulation
CLIP-seqRNA binding profile if R694 is an RNA-binding proteinDirect RNA targets of R694
ChIP-seqDNA interactions if R694 has DNA-binding propertiesGenomic regions regulated by R694
Nanopore sequencingLong-read sequencing for structural variantsImpact of R694 on viral genome organization

The MinION nanopore sequencing platform has already been successfully applied to study viral genomes, as demonstrated in the sequencing of E. coli using R9.0 chemistry with high accuracy (99.9% of "pass" template reads were mappable) . Similar approaches could provide insights into R694's role in genomic processes.

What are the most effective strategies for developing antibodies against R694 for functional studies?

Developing effective antibodies against R694 for functional studies requires a strategic approach:

  • Epitope selection:

    • Analyze R694 sequence for antigenic regions using prediction algorithms

    • Design multiple peptides representing different regions of the protein

    • Include both linear and conformational epitopes if structural information is available

  • Production approaches:

    • Generate polyclonal antibodies for broad epitope recognition

    • Develop monoclonal antibodies for specific applications requiring high reproducibility

    • Consider recombinant antibody fragments for specialized applications

  • Validation methods:

    • Western blot against both recombinant R694 and native protein in viral lysates

    • Immunoprecipitation followed by mass spectrometry

    • Immunofluorescence with competing peptides as specificity controls

    • Testing in R694-silenced samples as negative controls

This approach aligns with successful antibody development strategies used for other mimivirus proteins, as demonstrated in immunogold studies of fiber-associated proteins .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.