Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein R695 (MIMI_R695)

Shipped with Ice Packs
In Stock

Description

Overview

Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein R695 (MIMI_R695) is a protein derived from the Acanthamoeba polyphaga mimivirus (APMV). MIMI_R695 is considered an uncharacterized protein, meaning its specific function within the virus is not yet fully understood .

General Information

CharacteristicDescription
NameRecombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein R695 (MIMI_R695)
Source OrganismAcanthamoeba polyphaga mimivirus (APMV)
Product TypeRecombinant Protein
Uniprot IDQ5UNW0
Amino Acid SequenceMATNTSSNLLTNPYTEREKKLIDEAYYRDLKYNLTSKSRWKFIGDVSETLSQICVGTSSVLAFASGFFEDIDILAFVAGTVGVGSLVLLQFSSYAMKESSERTQQVNVILTKLGLETIPDIVVEPSIIKARLQGELGEQENDVVIEV
Expression Region1-147 amino acids

Research Applications

As an uncharacterized protein, MIMI_R695 may be a subject of interest in research aimed at elucidating the functions and mechanisms of large viruses like APMV. Further studies are needed to determine the precise role of MIMI_R695 in the viral life cycle or its interactions with the host.

Table 1: Guidelines for Constructing Effective Tables

GuidelineDescription
Clear TitleThe title should clearly and concisely describe the content of the table.
Descriptive Column HeadingsColumn headings should accurately indicate the nature of the data presented in each column, including units of measurement.
Self-ExplanatoryTables should be designed to be understandable on their own, without requiring reference to the main text.
Relevant DataOnly include data that is relevant to the research question(s) and objectives.
Appropriate FormattingUse consistent formatting throughout the table, including the number of decimal places and the alignment of data.
Avoid RedundancyDo not repeat data from the text in the tables; instead, use tables to provide more detailed or specific information.
Statistical InformationIf applicable, include relevant statistical information such as means, standard deviations, and p-values in the table or in footnotes.
FootnotesUse footnotes to explain abbreviations, symbols, or any other information necessary to understand the table.
Ethical ConsiderationsEnsure that the presentation of data in tables adheres to ethical guidelines, including protecting the privacy of participants and avoiding any misrepresentation of the data.
AccessibilityDesign tables to be accessible to all readers, including those with disabilities. This may involve using appropriate color contrasts and providing alternative text descriptions for screen readers.

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and pre-arranged. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting to -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: While the tag type is determined during production, we prioritize requests for specific tags. Please indicate your preferred tag type for prioritized development.
Synonyms
MIMI_R695; Uncharacterized protein R695
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-147
Protein Length
full length protein
Species
Acanthamoeba polyphaga mimivirus (APMV)
Target Names
MIMI_R695
Target Protein Sequence
MATNTSSNLLTNPYTEREKKLIDEAYYRDLKYNLTSKSRWKFIGDVSETLSQICVGTSSV LAFASGFFEDIDILAFVAGTVGVGSLVLLQFSSYAMKESSERTQQVNVILTKLGLETIPD IVVEPSIIKARLQGELGEQENDVVIEV
Uniprot No.

Target Background

Database Links

KEGG: vg:9925347

Subcellular Location
Virion. Host membrane; Single-pass membrane protein.

Q&A

How does MIMI_R695 fit into the broader context of mimivirus proteins?

MIMI_R695 is one of many ORFan proteins (proteins with no detectable homologs in other organisms) encoded by the mimivirus genome. Proteomic analyses of mimivirus have identified 114 distinct proteins incorporated into the viral particle, demonstrating that many ORFan gene products contribute to the structure of the mimivirus particle .

While some ORFan proteins like MIMI_L724 and MIMI_L725 have been shown to have antigenic properties and are located on the surface of the viral particle, MIMI_R695 has not yet been specifically characterized in terms of its location or function in the viral structure . Understanding MIMI_R695 could provide insights into the unique biology of mimiviruses and their evolutionary history.

What are the optimal expression systems for producing recombinant MIMI_R695?

Based on current research protocols, E. coli has been successfully used as an expression system for MIMI_R695. The protein can be expressed with an N-terminal His-tag to facilitate purification . The typical expression workflow includes:

  • Codon optimization for bacterial expression

  • Subcloning into an appropriate expression vector

  • Transformation into an E. coli strain such as BL21(DE3)

  • Induction of protein expression

  • Purification using affinity chromatography

When designing an expression strategy, researchers should consider:

Expression SystemAdvantagesLimitationsBest For
E. coliHigh yield, cost-effective, rapid growthLimited post-translational modificationsBasic structural studies, antibody production
YeastSome eukaryotic post-translational modificationsModerate yieldFunctional studies requiring glycosylation
Insect cellsBetter eukaryotic post-translational modificationsHigher cost, longer production timeStudies requiring folding similar to viral environment
Mammalian cellsMost authentic post-translational modificationsHighest cost, most complex systemInteraction studies with host factors

For most basic characterization studies, E. coli expression has proven sufficient for MIMI_R695 .

What experimental design strategies are most effective for characterizing uncharacterized viral proteins like MIMI_R695?

For characterizing uncharacterized proteins like MIMI_R695, a quasi-experimental approach with appropriate controls is recommended. Based on the literature on experimental design in medical informatics and virology research, a combination of approaches yields the most robust results :

  • Comparative proteomics studies: Compare the expression patterns of MIMI_R695 under different conditions (e.g., different stages of viral infection).

  • Localization studies: Use immunogold labeling with antibodies against MIMI_R695 to determine its location within the viral particle or infected cells, similar to studies done with MIMI_L725 .

  • Protein-protein interaction studies: Employ co-immunoprecipitation, yeast two-hybrid, or pull-down assays to identify proteins that interact with MIMI_R695.

  • Functional genomics approach: Use gene knockout or knockdown techniques followed by phenotypic analysis.

The strongest experimental design would include:

Quasi-experimental Design TypeDesign NotationApplication to MIMI_R695 Research
Untreated control group with dependent pretest and posttest samplesIntervention group: O1a X O2a
Control group: O1b O2b
Compare wild-type mimivirus with MIMI_R695 mutants
Multiple pretest and posttest observationsO1 O2 O3 O4 O5 X O6 O7 O8 O9 O10Track MIMI_R695 expression throughout viral infection cycle

Where O = Observational Measurement and X = Intervention Under Study .

What are the most effective purification methods for recombinant MIMI_R695?

Recombinant MIMI_R695 expressed with a His-tag can be effectively purified using the following protocol:

  • Cell lysis in Tris/PBS-based buffer

  • Nickel affinity chromatography for primary purification

  • Size exclusion chromatography for further purification

  • Quality assessment via SDS-PAGE (aim for >90% purity)

  • Storage in Tris/PBS-based buffer with 6% Trehalose, pH 8.0

For long-term storage, it is recommended to add 5-50% glycerol and aliquot for storage at -20°C/-80°C. Repeated freeze-thaw cycles should be avoided, and working aliquots can be stored at 4°C for up to one week .

The protein can be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For experiments requiring high purity, additional purification steps such as ion exchange chromatography may be necessary.

What analytical techniques are most informative for studying the structure and function of MIMI_R695?

To comprehensively characterize MIMI_R695, several complementary analytical techniques should be employed:

  • Structural Analysis:

    • X-ray crystallography or cryo-EM for tertiary structure

    • Circular dichroism (CD) for secondary structure elements

    • Mass spectrometry for post-translational modifications

  • Functional Analysis:

    • Glycosylation analysis using GlycoProfile III fluorescence assay

    • Enzymatic activity assays based on predicted functions

    • Western blot with patient sera to assess antigenicity

  • Interaction Analysis:

    • Surface plasmon resonance (SPR) for binding kinetics

    • Pull-down assays with host cell extracts

    • Two-way co-immunoprecipitation, similar to methods used for NME1 and DNM2 interaction studies

For a comprehensive proteomic analysis, a combination of 1D electrophoresis coupled with LC-MS/MS and 2D gels coupled to MALDI-TOF-MS is recommended, as this approach eliminates methodological deficiencies encountered in separating low-abundance and hydrophobic proteins .

How should researchers approach data analysis when studying uncharacterized proteins like MIMI_R695?

When analyzing data related to uncharacterized proteins like MIMI_R695, a systematic approach is essential:

  • Sequence analysis:

    • Compare to other mimivirus proteins

    • Conduct in silico functional prediction using tools like BLAST, InterProScan, and PFAM

    • Analyze for conserved domains, transmembrane regions, and signal peptides

  • Experimental data analysis:

    • Use appropriate statistical methods for comparing experimental groups

    • Consider quasi-experimental design approaches when analyzing intervention studies

    • Employ multiple pretest and posttest observations spaced at equal intervals for time-course studies

  • Visualization and reporting:

    • Use appropriate tables to enhance trustworthiness in qualitative research

    • Present data in a format that enhances transparency related to potential threats to internal and external validity

    • Follow best practices for creating descriptive tables (Table 1) in epidemiologic and clinical research papers

Table TypeContribution to ResearchExample Application for MIMI_R695
Data source tableFacilitates assessment of data credibilityList all experimental approaches used to characterize MIMI_R695
Concept-evidence tableGrounds interpretations in empirical evidencePresent evidence for putative functions of MIMI_R695
Cross-case analysis tableFacilitates systematic comparisonsCompare MIMI_R695 characteristics with other mimivirus proteins
Temporally ordered tableTracks empirical support for temporal patternsDocument MIMI_R695 expression during viral infection stages

What bioinformatic approaches are useful for predicting the function of MIMI_R695?

For uncharacterized proteins like MIMI_R695, bioinformatic prediction can provide valuable hypotheses about function:

  • Sequence-based prediction:

    • Homology detection using sensitive methods like HHpred or HMMER

    • Secondary structure prediction using PSIPRED

    • Disorder prediction using IUPred2A

    • Transmembrane topology prediction using TMHMM

  • Structure-based prediction:

    • Ab initio structure prediction using AlphaFold2 or RoseTTAFold

    • Molecular dynamics simulations to identify potential binding pockets

    • Docking studies with potential ligands or interaction partners

  • Functional annotation:

    • Gene Ontology term prediction based on structure

    • Network-based function prediction using known viral-host protein interactions

    • Comparison with other mimivirus proteins of known function

These predictions should be used to design targeted experiments for validation, creating an iterative process between computational prediction and experimental verification.

How might MIMI_R695 contribute to mimivirus infectivity and replication?

While the specific function of MIMI_R695 remains unknown, research on other mimivirus proteins suggests potential roles:

  • Structural component: Many ORFan proteins in mimivirus serve as structural components of the viral particle .

  • Host interaction: MIMI_R695 might interact with host factors to facilitate virus entry or replication, similar to other viral proteins.

  • Enzymatic activity: The protein sequence might harbor cryptic enzymatic functions, as seen with other initially uncharacterized viral proteins.

  • Immune evasion: Some viral proteins function to evade or suppress host immune responses.

To investigate these possibilities, researchers could employ a transfection approach similar to that used in a study where mimivirus DNA was transfected into Acanthamoeba castellanii to generate infectious virions . This study revealed the need for at least four uncharacterized proteins (L442, L724, L829, and R387) for DNA-mediated APMV generation. MIMI_R695 could be included in similar knockout studies to assess its importance in viral replication.

What role might post-translational modifications play in MIMI_R695 function?

Post-translational modifications (PTMs) could significantly impact MIMI_R695 function. Mimivirus contains six ORFs encoding putative glycosyltransferases and likely provides its own glycosylation machinery . 2D gel profiles of mimivirus proteins have revealed cleaved proteins and various isoforms due to protein glycosylation.

To investigate PTMs in MIMI_R695:

  • Use mass spectrometry to identify potential modification sites

  • Apply glycosylation-specific staining methods like GlycoProfile III fluorescence assay

  • Compare E. coli-expressed MIMI_R695 (minimal PTMs) with protein expressed in eukaryotic systems

  • Examine the impact of PTMs on protein-protein interactions and localization

Understanding these modifications could provide crucial insights into the protein's function and regulation within the viral life cycle.

What experimental approaches could determine if MIMI_R695 has antigenic properties?

To investigate the potential antigenic properties of MIMI_R695, researchers could employ approaches similar to those used for MIMI_L724 and MIMI_L725 :

  • Immunization studies:

    • Immunize mice with purified recombinant MIMI_R695

    • Collect sera and test reactivity against the recombinant protein using ELISA and Western blotting

    • Analyze cross-reactivity with other mimivirus proteins

  • Epitope mapping:

    • Generate a panel of overlapping peptides covering the MIMI_R695 sequence

    • Identify specific epitopes recognized by antibodies

    • Determine if these epitopes are accessible on the surface of the viral particle

  • Immunogold electron microscopy:

    • Generate monoclonal antibodies against MIMI_R695

    • Use these antibodies in immunogold labeling experiments

    • Determine if MIMI_R695 is exposed on the viral surface, similar to studies done with MIMI_L725

  • Human sera testing:

    • Screen sera from individuals with confirmed Acanthamoeba polyphaga mimivirus exposure

    • Test reactivity against recombinant MIMI_R695

    • Compare with reactivity against other mimivirus proteins of known antigenicity

How can researchers design experiments to understand MIMI_R695's role in the context of the complete mimivirus proteome?

To understand MIMI_R695 within the broader context of the mimivirus proteome, researchers should:

  • Comparative proteomics:

    • Compare the expression pattern of MIMI_R695 with other mimivirus proteins during different stages of infection

    • Use quantitative proteomics (e.g., SILAC or TMT labeling) to track changes in abundance

  • Protein interaction networks:

    • Perform immunoprecipitation followed by mass spectrometry to identify interaction partners

    • Construct a protein-protein interaction network including MIMI_R695

    • Use this network to infer potential functions based on the "guilt by association" principle

  • Gene knockout studies:

    • Create mimivirus variants with MIMI_R695 knocked out or mutated

    • Assess the impact on viral replication, structure, and infectivity

    • Compare with knockouts of other mimivirus proteins to identify functional relationships

  • Evolutionary analysis:

    • Compare MIMI_R695 across different mimivirus strains and related giant viruses

    • Identify conserved regions that might indicate functional importance

    • Reconstruct the evolutionary history of this protein within the context of mimivirus evolution

This multi-layered approach would provide a comprehensive understanding of MIMI_R695's role in the viral life cycle and potentially reveal unexpected functions or interactions.

What are the most promising future research directions for understanding MIMI_R695?

Based on current knowledge and technological capabilities, several research directions show particular promise:

  • Structural biology approaches:

    • Determining the high-resolution 3D structure of MIMI_R695 using X-ray crystallography or cryo-EM

    • Using structural information to predict function and potential interaction partners

  • Systems biology integration:

    • Incorporating MIMI_R695 into comprehensive models of mimivirus infection

    • Understanding its place within viral-host interaction networks

  • Evolutionary analysis:

    • Searching for distant homologs in other giant viruses or cellular organisms

    • Tracing the evolutionary history and potential functional shifts

  • Functional genomics:

    • CRISPR-based screens to identify host factors that interact with MIMI_R695

    • Viral genetic manipulation to understand the protein's role in viral fitness

  • Translational applications:

    • Exploring potential diagnostic applications if MIMI_R695 proves immunogenic

    • Investigating whether MIMI_R695 could be a target for antiviral interventions

These approaches, especially when combined, offer the potential to transform our understanding of this uncharacterized protein and contribute to broader knowledge about mimivirus biology.

What methodological challenges must be overcome in MIMI_R695 research?

Several methodological challenges remain in studying MIMI_R695:

  • Expression and purification optimization:

    • Ensuring proper folding and post-translational modifications

    • Scaling up production for structural studies

  • Functional assay development:

    • Creating specific assays without prior knowledge of function

    • Avoiding false positives in interaction studies

  • Genetic manipulation of mimiviruses:

    • Efficiently generating gene knockouts or modifications

    • Separating direct from indirect effects in complex viral systems

  • Computational prediction limitations:

    • Addressing the lack of close homologs for comparative analysis

    • Validating in silico predictions experimentally

  • Experimental design constraints:

    • Selecting appropriate controls for an uncharacterized protein

    • Developing robust quasi-experimental designs that minimize bias

Overcoming these challenges will require innovative approaches and potentially the development of new methodologies specific to giant virus research.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.