Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein R799 (MIMI_R799)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If a specific tag type is required, please inform us; we will prioritize its use in production.
Synonyms
MIMI_R799; Uncharacterized protein R799
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-201
Protein Length
full length protein
Species
Acanthamoeba polyphaga mimivirus (APMV)
Target Names
MIMI_R799
Target Protein Sequence
MININNNMKTIIILTIMILTIIIFTRTINGLQLEPVKFMNQKSGLIEIASNNLNLQSLTT SVKNGLIAKSVNLNDNFINSVSNEIYLALGVTNTNVQRMTWQVNIASNVGTMDVFYIEAT IGEKFVVINFHTIQITQPMPQLYDVVEKCERTGSRRYGIAGPRARECRYHNVPRSLNTDE LTLVTKTLESKVQEAIKIMLQ
Uniprot No.

Target Background

Database Links

KEGG: vg:9925461

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is known about the structural features of MIMI_R799?

MIMI_R799 is an uncharacterized protein from Acanthamoeba polyphaga mimivirus, a giant virus with a 1.2-Mb genome encoding 979 proteins . While specific structural information about R799 remains limited, researchers can employ several approaches to predict and analyze its structure:

Computational analysis using tools like DELTA-BLAST (Domain Enhanced Lookup Time Accelerated BLAST) can identify conserved domains and distant homologs that might suggest functional properties . For structural prediction, approaches used for other mimivirus proteins can be applied, including secondary structure prediction algorithms and more advanced protein modeling tools like AlphaFold2, which have revolutionized protein structure prediction capabilities .

For experimental structural characterization, researchers should consider:

  • Expressing and purifying the recombinant protein

  • Employing circular dichroism spectroscopy for secondary structure assessment

  • Attempting X-ray crystallography or cryo-EM for high-resolution structural determination

  • Investigating potential post-translational modifications that could affect structure, similar to studies on mimivirus collagen-modifying enzymes

The mimivirus genome includes numerous ORFans and proteins with unknown functions (>70% of predicted genes) , making R799 part of a substantial group of proteins requiring structural characterization to understand viral biology.

What experimental approaches are recommended for initial functional characterization of MIMI_R799?

Initial functional characterization should follow a systematic workflow:

  • Bioinformatic analysis:

    • Sequence comparison with characterized proteins

    • Domain prediction and structural modeling

    • Evolutionary analysis across giant virus families

  • Gene silencing studies:

    • Design siRNA specifically targeting R799 mRNA

    • Transfect into infected Acanthamoeba using protocols established for other mimivirus proteins like R458

    • Validate silencing efficiency via RT-PCR at approximately 6 hours post-infection

    • Monitor effects on viral replication cycle, focusing on:

      • Eclipse phase timing

      • Viral factory formation

      • Growth kinetics

      • Final viral particle production

  • Protein expression and purification:

    • Express in bacterial systems with appropriate tags

    • Optimize expression conditions to ensure proper folding

    • Address challenges specific to viral proteins, such as codon usage and potential toxicity

  • Protein localization:

    • Generate specific antibodies for immunofluorescence

    • Track localization during infection cycle

    • Compare timing with viral factory formation

The study of mimivirus protein R458 demonstrated that siRNA silencing resulted in delayed eclipse phase but unchanged final viral titer . Similar phenotypic analysis of R799 would provide valuable initial functional insights.

How does MIMI_R799 compare to other characterized mimivirus proteins?

While R799 remains uncharacterized, comparison with other mimivirus proteins provides contextual understanding:

Comparison with characterized mimivirus proteins:

ProteinFunctionSilencing phenotypeHomology to cellular proteinsReference
R458Translation initiationDelayed eclipse phase, normal final titerHomologous to translation initiation factors
R699Collagen glycosyltransferaseNot reportedHomologous to human collagen-modifying enzymes
MIMI_R799UnknownTo be determinedTo be investigated-

Mimivirus contains several categories of proteins:

  • Proteins involved in translation (like R458), which is unusual for viruses

  • Enzymes that modify host or viral proteins (like R699)

  • Structural components of the viral particle

  • Proteins that manipulate host processes

A genome-wide comparison between human and mimivirus identified 52 putative mimiviral proteins with human homologs . R799 should be analyzed in this context to determine if it belongs to this group of proteins potentially acquired from eukaryotic hosts during evolution.

The presence of translation-related components in mimivirus has triggered considerable interest in evolutionary biology , and characterization of additional proteins like R799 will further illuminate the evolutionary relationships between giant viruses and cellular organisms.

What methodologies are most effective for investigating MIMI_R799's role in mimivirus replication cycle?

To comprehensively investigate R799's role in viral replication, researchers should implement a multi-faceted approach:

  • Temporal expression profiling:

    • Quantify R799 mRNA and protein levels throughout the infection cycle

    • Determine whether R799 is an early or late gene

    • Correlate expression with key replication events

  • Gene silencing with phenotypic characterization:

    • Use siRNA to silence R799 expression as demonstrated for R458

    • Compare replication kinetics between wild-type and R799-silenced virus

    • Utilize immunofluorescence microscopy to track viral factory formation

    • Employ electron microscopy to examine virion morphology

  • Comparative proteomics:

    • Apply two-dimensional difference-in-gel electrophoresis (2D-DIGE) to compare protein profiles between wild-type and R799-silenced virus

    • Identify differentially expressed proteins via mass spectrometry

    • The R458 study identified 83 deregulated peptide spots corresponding to 32 different proteins, providing a methodological template

  • Host-pathogen interaction studies:

    • Identify host proteins that interact with R799 using co-immunoprecipitation

    • Investigate changes in host cell processes following R799 silencing

  • Functional complementation:

    • Develop systems to express wild-type or mutant R799 in silenced backgrounds

    • Determine which domains are essential for function

The research on R458 demonstrated that silencing delayed viral factory formation and the eclipse phase by at least 2 hours compared to wild-type virus . Similar timing analyses for R799 would help position its function within the viral replication cycle.

How might evolutionary analysis of MIMI_R799 inform our understanding of giant virus biology?

Evolutionary analysis of R799 can provide significant insights into giant virus evolution and host-virus relationships:

  • Ortholog identification and analysis:

    • Search for R799 homologs in other giant viruses (Megavirus, Pandoravirus, Pithovirus)

    • Identify potential cellular homologs (as done for other mimivirus proteins)

    • Construct phylogenetic trees to visualize evolutionary relationships

  • Selective pressure analysis:

    • Calculate dN/dS ratios to identify regions under positive or purifying selection

    • Map selection patterns onto structural predictions

    • Correlate evolutionary conservation with predicted functional domains

  • Domain architecture comparisons:

    • Analyze domain organization across related proteins

    • Identify conserved motifs versus variable regions

    • Infer functional importance from evolutionary conservation

  • Horizontal gene transfer assessment:

    • Evaluate evidence for HGT using phylogenetic incongruence

    • Compare sequence characteristics with potential donor lineages

    • Determine if R799 originated from host acquisition or is ancestral to giant viruses

The genome-wide comparison between human and mimivirus that identified 52 human-mimivirus homologous proteins demonstrated that studying protein homology can reveal important functional networks . The largest network identified contained collagen and collagen-modifying enzymes, highlighting the value of evolutionary approaches in functional discovery .

Understanding whether R799 represents a core giant virus protein or a more recently acquired gene will inform broader questions about mimivirus evolution and the boundaries between viral and cellular life.

What are the potential interactions between MIMI_R799 and host cellular machinery?

Investigating interactions between R799 and host machinery requires systematic analysis of both direct and indirect effects:

  • Protein-protein interaction identification:

    • Affinity purification coupled with mass spectrometry

    • Yeast two-hybrid screening against host proteome

    • Proximity labeling approaches (BioID, APEX)

    • Validation via co-immunoprecipitation and co-localization studies

  • Impact on host transcriptome:

    • RNA-seq comparing wild-type infection versus R799-silenced infection

    • Temporal analysis to identify early versus late effects

    • Pathway enrichment analysis of differentially expressed genes

  • Alterations to host proteome:

    • Quantitative proteomics comparing host protein levels during wild-type versus R799-silenced infection

    • Pulse-chase experiments to examine protein turnover rates

    • Post-translational modification analysis

  • Metabolic reprogramming assessment:

    • Metabolomic profiling during infection

    • Analyze changes to key metabolic pathways

    • Compare with impacts of other mimivirus proteins

  • Host defense modulation:

    • Examine effects on host antiviral responses

    • Investigate potential immune evasion functions

The study of mimivirus proteins like R458 revealed their importance in viral factory development , while R699 was identified as a collagen glycosyltransferase potentially involved in host-virus interactions . Similar detailed functional analysis of R799 would illuminate its specific role in virus-host dynamics.

Table: Potential R799-host interaction mechanisms based on precedents from other mimivirus proteins:

Interaction mechanismPrecedent in mimivirusExperimental approach for R799
Translation machinery manipulationR458 (translation initiation factor) Polysome profiling, translation efficiency assays
Host protein modificationR699 (collagen glycosyltransferase) PTM analysis, in vitro enzymatic assays
Viral factory recruitmentR458 (delayed factory formation when silenced) Time-lapse microscopy, proximity labeling
Host defense suppressionPredicted for multiple mimivirus proteinsImmune signaling pathway analysis

What are the optimal conditions for siRNA-mediated silencing of MIMI_R799 expression?

Based on successful siRNA silencing of mimivirus R458 , the following protocol is recommended for R799:

  • siRNA design parameters:

    • Target unique regions of R799 sequence with 40-60% GC content

    • Design 2-3 different siRNA duplexes targeting different regions

    • Include non-targeting negative controls

    • Use algorithms that minimize off-target effects

  • Transfection procedure:

    • Infect Acanthamoeba polyphaga with mimivirus

    • At 3 hours post-infection, transfect cells with R799-targeting siRNA using Lipofectamine

    • Include fluorescently labeled siRNA to confirm transfection efficiency

    • Maintain appropriate controls (mock-transfected, non-targeting siRNA)

  • Validation of silencing:

    • Extract RNA at 6 hours post-infection

    • Perform RT-PCR to quantify R799 mRNA levels

    • Compare expression to housekeeping genes and other viral genes

    • Calculate silencing efficiency relative to controls

  • Optimization considerations:

    • Test multiple siRNA concentrations (10-100 nM)

    • Evaluate different transfection reagents if Lipofectamine yields suboptimal results

    • Adjust timing of transfection if R799 expression differs from R458

The R458 study demonstrated successful silencing with significant phenotypic effects (delayed eclipse phase) using this approach . A similar methodological framework should be effective for R799, with adaptations based on its specific expression pattern during infection.

How can I develop specific antibodies against MIMI_R799 for research applications?

Development of R799-specific antibodies requires careful antigen design and validation:

  • Antigen preparation options:

    a. Recombinant full-length protein:

    • Express in E. coli with purification tags

    • Address potential challenges in full-length protein expression

    • Purify under conditions maintaining native conformation

    b. Synthetic peptide approach:

    • Identify antigenic epitopes using prediction algorithms

    • Select 15-20 amino acid peptides unique to R799

    • Synthesize and conjugate to carrier proteins (KLH or BSA)

  • Antibody production strategy:

    a. Polyclonal antibodies:

    • Immunize rabbits with purified antigen

    • Collect serum at appropriate intervals

    • Affinity-purify antibodies against the immunizing antigen

    b. Monoclonal antibodies:

    • Immunize mice following standard protocols

    • Perform hybridoma fusion and screening

    • Select and expand positive clones

  • Validation procedures:

    • Western blot analysis of mimivirus-infected cell lysates

    • Immunofluorescence microscopy of infected cells

    • Pre-absorption controls with recombinant antigen

    • Testing against R799-silenced virus as negative control

    • Cross-reactivity assessment with other mimivirus proteins

  • Application-specific optimization:

    • Determine optimal antibody concentrations for different applications

    • Evaluate fixation conditions for immunofluorescence

    • Optimize blocking and washing conditions

A similar approach was likely used to generate antibodies for detecting viral factories in the R458 silencing study , which successfully visualized factory formation using immunofluorescence microscopy with mimivirus-specific polyclonal antibodies.

What proteomics approaches are most effective for identifying the functional network of MIMI_R799?

Based on successful proteomics studies of other mimivirus proteins, the following approaches are recommended:

  • Two-dimensional difference gel electrophoresis (2D-DIGE):

    • Compare protein profiles between wild-type and R799-silenced mimivirus

    • Process samples in quadruplicate as done in the R458 study

    • Identify differentially expressed proteins via mass spectrometry

    • This approach successfully identified 32 deregulated proteins following R458 silencing

  • Affinity purification-mass spectrometry (AP-MS):

    • Express tagged versions of R799

    • Perform pull-downs from infected cell lysates

    • Identify co-purifying proteins by LC-MS/MS

    • Include appropriate controls (tag-only, unrelated viral protein)

  • Crosslinking mass spectrometry:

    • Apply protein crosslinking during infection

    • Isolate R799-containing complexes

    • Identify crosslinked partners by specialized MS analysis

    • Map interaction interfaces

  • Functional network construction:

    • Organize identified proteins using Gene Ontology (GO) and REACTOME pathway mapping

    • Construct interaction networks based on co-regulated proteins

    • Identify functional clusters and pathways

    • This approach successfully identified the function of R699 as a collagen glycosyltransferase

The R458 study revealed that silencing resulted in deregulation of proteins associated with viral particle structures, transcriptional machinery, oxidative pathways, modification of proteins/lipids, and DNA topology/repair . Similar comprehensive analysis of the R799-associated proteome would provide valuable insights into its functional network.

How should researchers interpret viral fitness changes following MIMI_R799 silencing?

Interpreting viral fitness changes after R799 silencing requires comprehensive analysis across multiple parameters:

  • Growth kinetics analysis:

    • Plot one-step growth curves for wild-type and R799-silenced virus

    • Quantify key parameters:

      • Eclipse phase duration

      • Growth rate during exponential phase

      • Final viral titer

      • Burst size (virions per cell)

    • The R458 study revealed a significantly longer eclipse phase in silenced virus compared to wild-type

  • Viral factory assessment:

    • Monitor factory formation using immunofluorescence microscopy

    • Compare timing of factory appearance between wild-type and silenced virus

    • Evaluate factory morphology and distribution

    • R458 silencing delayed factory formation by at least 2 hours

  • Virion production and morphology:

    • Quantify particle production by electron microscopy or flow virometry

    • Assess particle-to-PFU ratio to determine infectious proportion

    • Examine virion morphology for structural abnormalities

    • R458 silencing affected growth rate but not final viral particle production

  • Comparative phenotypic analysis:

    ParameterWild-type virusR799-silenced virusInterpretation guidance
    Eclipse phase timingBaselineDelayed/unchangedIf delayed: potential role in early infection
    Factory morphologyNormalAltered/unchangedIf altered: potential structural role
    Replication rateNormalReduced/unchangedIf reduced: role in replication efficiency
    Final titerBaselineReduced/unchangedIf unchanged despite growth delay: non-essential role
  • Validation approaches:

    • Complementation with wild-type R799 to confirm phenotype specificity

    • Dose-response relationship between silencing efficiency and phenotype severity

    • Multiple biological replicates with statistical analysis

R458 silencing produced a distinct phenotype (delayed eclipse phase but normal final titer) , suggesting a role in replication timing rather than essential virion production. Similar careful phenotypic characterization of R799 would position its function within the viral life cycle.

What approaches can distinguish between direct and indirect effects of MIMI_R799 on viral processes?

Differentiating direct from indirect effects requires systematic experimental design:

  • Temporal analysis:

    • Track the precise timing of events following R799 silencing

    • Early effects (0-6h post-silencing) are more likely direct consequences

    • Late effects may represent downstream impacts

    • Create a temporal map of altered processes

  • Dose-dependency studies:

    • Create a gradient of R799 silencing using varying siRNA concentrations

    • Measure phenotypic outcomes across the gradient

    • Direct effects typically show stronger dose-dependency

    • Quantify the relationship using correlation analysis

  • Protein-protein interaction evidence:

    • Demonstrate physical interactions between R799 and affected components

    • Map interaction domains using truncation mutants

    • Show correlation between binding affinity and functional impact

    • Employ techniques like co-immunoprecipitation or proximity labeling

  • Comparative network analysis:

    • Compare proteome changes caused by R799 silencing with other perturbations

    • Identify protein changes specific to R799 versus general stress responses

    • Construct computational regulatory networks from proteomics data

    • Predict the cascade of events following R799 disruption

  • Functional complementation:

    • Rescue experiments with wild-type R799

    • Test domain-specific mutants to map functional regions

    • Direct effects should be rescued by wild-type but not by non-functional mutants

  • In vitro reconstitution:

    • Purify components of affected pathways

    • Attempt to reconstitute processes with purified R799

    • Demonstrate direct biochemical activity

The delayed eclipse phase observed with R458 silencing represents a phenotype that could have either direct causes (direct involvement in factory formation) or indirect causes (affecting expression of factory components). Similar careful dissection of R799's effects would clarify its position in viral regulatory networks.

How can researchers integrate multi-omics data to develop a comprehensive model of MIMI_R799 function?

Developing a comprehensive model of R799 function requires integrating data from multiple experimental approaches:

  • Data integration workflow:

    • Collect data across multiple platforms:

      • Genomics (evolutionary conservation, selective pressure)

      • Transcriptomics (expression timing, co-expression patterns)

      • Proteomics (interaction partners, expression changes upon silencing)

      • Phenomics (viral growth characteristics, morphological changes)

    • Normalize and standardize datasets for comparison

    • Apply integrative computational approaches

  • Network construction and analysis:

    • Build protein interaction networks from proteomics data

    • Overlay expression data onto networks

    • Identify subnetworks affected by R799 silencing

    • Apply similar network approaches to those used for R699 functional identification

  • Temporal mapping:

    • Organize all data points chronologically

    • Create a timeline of R799 activity during infection

    • Compare with known viral lifecycle events

    • The R458 study positioned its function relative to eclipse phase timing

  • Causal modeling:

    • Develop directed graphs representing cause-effect relationships

    • Test models against experimental data

    • Refine based on additional validation experiments

    • Generate testable predictions

  • Visualization and communication:

    • Create comprehensive visual models of R799 function

    • Integrate structural, interaction, and functional data

    • Develop dynamic models showing temporal aspects

    • Compare with models of better-characterized mimivirus proteins

The R458 study integrated growth kinetics, immunofluorescence microscopy, and proteomics to develop a functional model positioning R458 in viral factory formation . The R699 study combined comparative genomics with biochemical characterization to identify enzymatic function . Similar multi-layered approaches would yield a comprehensive model of R799 function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.