Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein R809 (MIMI_R809)

Shipped with Ice Packs
In Stock

Description

Production and Handling Guidelines

Suppliers recommend :

  • Reconstitution: Use deionized water to achieve 0.1–1.0 mg/mL concentrations.

  • Stability: Avoid freeze-thaw cycles; working aliquots stable at 4°C for ≤1 week.

  • Applications: Suggested for ELISA, antibody production, and structural studies.

Biological Context of APMV Proteins

While MIMI_R809’s function is unstudied, insights can be drawn from related mimivirus proteins:

  • Genomic Uniqueness: APMV encodes atypical enzymes like aminoacyl-tRNA synthetases and collagen-modifying proteins (e.g., R699, a collagen glucosyltransferase) .

  • Host Interactions: APMV proteins often exploit Acanthamoeba host machinery, with some homologs detected in vertebrate systems .

  • Research Gap: Unlike characterized mimivirus proteins (e.g., DNA polymerases), R809 lacks functional annotation or pathway associations .

Research Implications

The commercial availability of recombinant MIMI_R809 enables:

  • Antibody Development: For tracking APMV infections in amoebal or accidental human host models .

  • Structural Studies: Cryo-EM or crystallography to resolve its tertiary structure.

  • Functional Screens: Testing roles in viral replication, host immune evasion, or enzymatic activity.

Limitations and Future Directions

  • Uncharacterized Function: No peer-reviewed studies directly investigate MIMI_R809’s role in APMV biology .

  • Supplier Data Gaps: Commercial documentation lacks enzymatic assay results or interaction partners.

  • Opportunities: Comparative studies with homologous viral proteins (e.g., R699 ) could reveal conserved mechanisms.

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will accommodate your request.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributors for specific delivery estimates.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can serve as a reference for your own preparations.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, the shelf life for liquid form is 6 months at -20°C/-80°C, while the lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
MIMI_R809; Uncharacterized protein R809
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-229
Protein Length
full length protein
Species
Acanthamoeba polyphaga mimivirus (APMV)
Target Names
MIMI_R809
Target Protein Sequence
MLEMQLFFVSYVLYGLGFVSLIFLPTEHQRLYYLHLVSVIIGLIANYEMKFNILLAMFHS AVHNLWPFLKNTGYDDTEKSVYDVFCHTIMMMLCYHRIYYSQNIVIDSEYLFHVLSVLFI LGAMINCLVSHLIIDSHHAQLHSIFEYTTIFQAVSTGYWVATMLWYNNLNHQDFYYHWLL WITLMTTNWFIYKFWPKLVGISMRYKYVEAVFIICTWYSGVLSSQKISC
Uniprot No.

Target Background

Database Links

KEGG: vg:9925472

Protein Families
Mimivirus L68/R809 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is MIMI_R809 and what is currently known about its function?

MIMI_R809 is an uncharacterized protein encoded by the Acanthamoeba polyphaga mimivirus (APMV) genome. The protein consists of 229 amino acids and is available as a recombinant protein expressed in E. coli with a His-tag . Despite being cataloged in protein databases, MIMI_R809 remains functionally uncharacterized, with no definitively assigned biochemical activities or structural roles.

The limited information available makes this protein an interesting target for functional genomics research, particularly as APMV is known for harboring numerous proteins that play critical roles in viral replication and host interaction. Comparative proteomic analyses of mimivirus factories at different infection time points (4h, 5.5h, and 7h post-infection) have demonstrated that viral protein composition changes dynamically throughout infection . While R809 is not specifically mentioned in these analyses, the methodology used to study other uncharacterized mimivirus proteins could be applied to investigate its function.

How should researchers approach the structural characterization of MIMI_R809?

Structural characterization of MIMI_R809 should follow a multi-method approach:

  • Bioinformatic prediction: Begin with sequence-based structure prediction using tools like AlphaFold, Phyre2, or I-TASSER to generate preliminary structural models.

  • Recombinant protein production: Express and purify the recombinant protein using the available His-tagged construct (as referenced in the Creative BioMart catalog) . Optimize expression conditions in E. coli to ensure proper folding and sufficient yield.

  • Experimental structure determination: Employ X-ray crystallography, nuclear magnetic resonance (NMR), or cryo-electron microscopy depending on protein properties.

  • Domain identification: Analyze for conserved domains that might provide functional insights, particularly since many mimivirus proteins contain domains with unexpected functions.

  • Post-translational modification analysis: Investigate potential modifications, as some mimivirus proteins (like R135) undergo glycosylation that may occur outside viral factories .

The purified protein can be subjected to circular dichroism spectroscopy to determine secondary structure content before proceeding to more resource-intensive structural studies.

What experimental systems are available for studying MIMI_R809 in the context of viral infection?

Several experimental systems can be employed to study MIMI_R809 in infection contexts:

  • Microinjection system: A methodology similar to that described for other mimivirus proteins can be adapted. This involves microinjecting viral DNA into Acanthamoeba castellanii amoebae to generate infectious virions . The microinjection solution typically includes fluorescent markers (e.g., Dextran Rhodamine B) to confirm successful injection, and the process requires careful monitoring of cell viability post-injection .

  • Viral factory isolation: Researchers can isolate mimivirus replication factories at different time points post-infection (4h, 5.5h, and 7h) using protocols established for proteomic analysis . This approach allows examination of MIMI_R809's presence and potential role in these virus-generated organelles.

  • Immunofluorescence microscopy: Custom antibodies against MIMI_R809 can be used to track its localization during infection, providing spatial and temporal information about its function.

  • Scanning electron microscopy (SEM): This technique has been successfully applied to isolated viral factories and could help determine if MIMI_R809 is associated with specific viral structures.

Each system provides different insights, and their combination would offer a comprehensive understanding of MIMI_R809's role in mimivirus biology.

What techniques are most effective for determining the function of uncharacterized proteins like MIMI_R809?

For uncharacterized mimivirus proteins like MIMI_R809, the following functional genomics approaches have proven most effective:

  • Gene knockouts via DNA transfection: Similar to studies with other mimivirus proteins (L442, L724, L829, and R387), researchers can use microinjection of modified viral DNA to assess whether MIMI_R809 is essential for virus replication . The protocol involves:

    • Extracting mimivirus DNA using methods like EZ1 DNA Tissue Kit

    • Filtering the extracted DNA through 0.22-μm-pore filters

    • Diluting to appropriate concentrations (approximately 10 ng/ml)

    • Optionally treating with proteinase K to remove proteins

    • Preparing microinjection solutions with fluorescent markers

    • Monitoring successful injections via fluorescence microscopy

  • Proteomics-driven functional assignment: Analyze MIMI_R809's expression pattern during infection phases and its association with specific viral structures. Compare with the dynamic protein composition observed in viral factories at different infection stages (4h, 5.5h, and 7h post-infection) .

  • Protein-protein interaction studies: Identify binding partners using pull-down assays, co-immunoprecipitation, or proximity labeling techniques, which may reveal functional associations with proteins of known function.

  • Comparative genomics: Analyze potential homologs or functionally related proteins in other giant viruses to infer function through evolutionary relationships.

  • Biochemical activity screening: Test purified MIMI_R809 against panels of substrates to identify potential enzymatic activities.

The combination of these approaches has successfully elucidated functions for previously uncharacterized mimivirus proteins like R135, a GMC-type oxidoreductase shown to be a component of mimivirus fibrils .

How can researchers assess MIMI_R809's potential role in mimivirus replication factories?

To determine MIMI_R809's role in mimivirus replication factories, researchers should consider this systematic approach:

  • Temporal proteomics analysis: Isolate viral factories at different time points (4h, 5.5h, and 7h post-infection) following established protocols . Analyze MIMI_R809's presence and abundance using mass spectrometry to establish its temporal expression pattern.

  • Factory purification and visualization: Purify viral factories using sucrose gradient ultracentrifugation and verify their integrity using scanning electron microscopy (SEM) . This allows detection of morphological changes in factories when MIMI_R809 is absent or modified.

  • Immunolocalization studies: Generate antibodies against MIMI_R809 and use immunofluorescence microscopy to track its localization within factories at different infection stages.

  • Co-localization with factory markers: Determine association with specific factory components by co-localization studies with known factory proteins identified in previous research .

  • Functional analysis through disruption: Design experiments that selectively inhibit MIMI_R809 expression or function and observe effects on factory formation, maturation, and viral production.

This methodology has previously revealed that mimivirus factories are dynamic structures with changing protein composition throughout the infection cycle , which suggests that MIMI_R809 may have a stage-specific role in viral replication.

What methods can be used to study potential post-translational modifications of MIMI_R809?

Post-translational modifications (PTMs) of mimivirus proteins can be critical for their function, as demonstrated by the glycosylation of R135 . To investigate PTMs of MIMI_R809, researchers should employ:

  • Mass spectrometry-based proteomic analysis:

    • Isolate MIMI_R809 from viral particles or infected cells

    • Perform tryptic digestion followed by LC-MS/MS analysis

    • Use specialized software to identify modification sites

    • Compare PTM patterns from different infection stages

  • Site-directed mutagenesis:

    • Identify potential modification sites through bioinformatic prediction

    • Generate mutants at these sites

    • Assess functional consequences in expression systems

  • Glycosylation analysis:

    • Use specific glycan staining methods

    • Apply enzymatic deglycosylation followed by mobility shift assays

    • Consider that glycosylation of mimivirus proteins like R135 may occur on host membranes outside viral factories

  • Phosphorylation studies:

    • Use phospho-specific antibodies

    • Employ Phos-tag SDS-PAGE to detect phosphorylated forms

    • Apply kinase/phosphatase inhibitors to identify regulatory pathways

  • In vitro modification systems:

    • Reconstitute potential modification systems using mimivirus or host enzymes

    • Monitor modification of recombinant MIMI_R809 under controlled conditions

Understanding MIMI_R809's modifications could provide crucial insights into its regulation and function during the mimivirus infection cycle.

What are the optimal conditions for expressing and purifying recombinant MIMI_R809?

Based on available information about mimivirus proteins and the specific characteristics of MIMI_R809, the following optimization protocol is recommended:

  • Expression system selection:

    • E. coli has been successfully used for MIMI_R809 expression with His-tag

    • Consider BL21(DE3) or Rosetta strains for potentially problematic codon usage

    • For difficult-to-express proteins, insect cell or mammalian expression systems may be alternatives

  • Expression optimization:

    • Test multiple induction temperatures (16°C, 25°C, 30°C)

    • Vary IPTG concentrations (0.1-1.0 mM)

    • Evaluate different induction durations (4h, 8h, overnight)

    • Consider auto-induction media for higher yields

  • Solubility enhancement:

    • Test fusion partners (MBP, SUMO, GST) if His-tag alone yields insoluble protein

    • Include solubility enhancers like sorbitol or arginine in expression media

    • Evaluate co-expression with molecular chaperones

  • Purification strategy:

    • Primary capture: Ni-NTA affinity chromatography

    • Secondary purification: Ion exchange chromatography

    • Polishing step: Size exclusion chromatography

    • Optional tag removal with appropriate protease

  • Buffer optimization:

    • Test pH range 6.0-8.0

    • Evaluate NaCl concentrations (150-500 mM)

    • Include stabilizers like glycerol (5-10%)

    • Consider reducing agents (DTT or TCEP) to prevent aggregation

Quality assessment should include SDS-PAGE, Western blotting, mass spectrometry, and activity assays if applicable. For structural studies, thermal shift assays can help identify optimal buffer conditions for protein stability.

How can researchers design experiments to localize MIMI_R809 during different stages of viral infection?

To track MIMI_R809 localization throughout the mimivirus infection cycle, implement the following experimental design:

  • Custom antibody development:

    • Generate polyclonal or monoclonal antibodies against recombinant MIMI_R809

    • Validate antibody specificity via Western blotting

    • Optimize for immunofluorescence applications

  • Time-course infection experiments:

    • Infect Acanthamoeba cells with mimivirus

    • Fix cells at multiple time points (0h, 2h, 4h, 5.5h, 7h, 12h post-infection)

    • These time points align with established viral factory development stages

  • Confocal microscopy analysis:

    • Co-stain with DNA markers (DAPI)

    • Include markers for viral factories

    • Perform z-stack imaging for 3D localization

  • Immuno-electron microscopy:

    • Apply gold-labeled antibodies to thin sections of infected cells

    • Focus on viral factories and virion assembly sites

    • Compare with SEM observations of purified factories

  • Live-cell imaging options:

    • Generate fluorescent protein fusions with MIMI_R809

    • Verify fusion protein functionality

    • Perform time-lapse imaging during infection

  • Subcellular fractionation verification:

    • Isolate viral factories at different time points using established protocols

    • Confirm MIMI_R809 presence by Western blotting

    • Compare with whole proteome analysis by mass spectrometry

This multi-method approach will provide comprehensive spatiotemporal information about MIMI_R809 during infection, particularly in relation to the dynamic viral factory structures observed in previous studies .

What controls should be included when studying MIMI_R809 in mimivirus infection models?

Robust experimental design for studying MIMI_R809 requires the following controls:

  • Negative controls for infection studies:

    • Uninfected Acanthamoeba cells processed identically to infected samples

    • Mock-injected cells when using microinjection approaches

    • Non-specific antibody controls for immunostaining

  • Positive controls for viral processes:

    • Well-characterized mimivirus proteins with known localization patterns

    • Include proteins known to be present in viral factories (from proteomic studies)

    • Track established viral factory markers alongside MIMI_R809

  • Functional validation controls:

    • Complementation controls if using knockout approaches

    • Rescue experiments with wild-type protein following modification studies

    • Dose-response relationships for inhibition studies

  • Technical controls for protein studies:

    • Empty vector controls for recombinant expression

    • Tag-only controls to distinguish tag artifacts from protein-specific effects

    • Proteinase K treatment of DNA extracts to ensure removal of associated proteins

  • Time-course controls:

    • Include all critical time points identified in factory development (4h, 5.5h, 7h)

    • Synchronize infections for comparable time point analysis

    • Include both early and late infection stages to capture the full range of potential functions

These controls are essential for interpreting the dynamic nature of viral replication factories and the specific contribution of MIMI_R809 to viral processes.

How should researchers interpret proteomic data to understand MIMI_R809's role in viral factories?

Proteomic data analysis for understanding MIMI_R809's function should follow this structured interpretation framework:

  • Temporal abundance profiling:

    • Plot MIMI_R809 abundance across infection time points (4h, 5.5h, 7h)

    • Compare with proteins of known function

    • Cluster proteins with similar expression patterns

    • Look for correlations with specific viral factory development stages

  • Comparative analysis with virion proteomics:

    • Determine if MIMI_R809 is present in both factories and mature virions

    • Compare with the distribution patterns observed for other proteins

    • Proteins present in factories but not virions often serve production-line functions

    • Proteins in virions but not late factories (like R135) may be added outside factories

  • Functional network construction:

    • Create interaction networks based on co-occurrence patterns

    • Apply guilt-by-association principles to infer function

    • Integrate with known protein-protein interaction data

  • Subcellular localization mapping:

    • Correlate proteomic data with immunolocalization results

    • Identify compartment-specific protein signatures

    • Map MIMI_R809 to specific factory substructures

  • Statistical validation:

    • Apply appropriate statistical tests to abundance differences

    • Calculate enrichment ratios between compartments

    • Perform multiple testing corrections for large-scale comparisons

This approach parallels the methodology used to analyze the dynamic protein composition of mimivirus factories, where significant differences were observed between early (4h) and late (7h) factories, providing insights into the viral assembly process .

What bioinformatic approaches can predict potential functions of MIMI_R809?

To predict functions of uncharacterized proteins like MIMI_R809, employ these bioinformatic strategies:

  • Sequence-based function prediction:

    • PSI-BLAST for distant homology detection

    • HHpred for sensitive profile-profile alignment

    • InterProScan for domain and motif identification

    • PFAM database searches for conserved domains

  • Structural bioinformatics:

    • AlphaFold or RoseTTAFold for structure prediction

    • DALI server for structural similarity searches

    • ProFunc for structure-based function prediction

    • Active site prediction using CASTp or similar tools

  • Genomic context analysis:

    • Examine neighboring genes in the mimivirus genome

    • Look for operonic structures or co-regulation patterns

    • Apply phylogenetic profiling across viral species

  • Network-based predictions:

    • Integrate with available protein-protein interaction data

    • Analyze co-expression patterns from infection time course data

    • Apply network-based function prediction algorithms

  • Machine learning approaches:

    • Use ensemble methods combining multiple prediction features

    • Apply deep learning models trained on viral protein functions

    • Validate predictions with experimental data

For mimivirus proteins, these approaches can be particularly informative when considering the unique evolutionary history of giant viruses and their relationship to cellular life forms. The analysis of protein distribution in factories and virions has already revealed functional insights for many mimivirus proteins , providing a framework for similar analyses of MIMI_R809.

How can evolutionary analysis inform our understanding of MIMI_R809?

Evolutionary analysis provides crucial context for understanding MIMI_R809's function through these methodological approaches:

  • Phylogenetic profiling across giant viruses:

    • Identify homologs in related nucleocytoplasmic large DNA viruses (NCLDVs)

    • Map presence/absence patterns across the viral tree of life

    • Correlate evolutionary conservation with functional importance

  • Sequence conservation analysis:

    • Generate multiple sequence alignments of homologs

    • Identify highly conserved residues that may be functionally critical

    • Calculate site-specific evolutionary rates using models like PAML

  • Domain architecture evolution:

    • Compare domain organization across homologs

    • Identify domain gain/loss events

    • Analyze fusion/fission events that may indicate functional relationships

  • Selection pressure analysis:

    • Calculate dN/dS ratios to identify selection signatures

    • Identify sites under positive or purifying selection

    • Correlate selection patterns with structural features

  • Host-virus co-evolution:

    • Look for potential horizontal gene transfer from hosts

    • Identify mimivirus proteins with eukaryotic signatures

    • Compare with patterns observed for characterized viral proteins

This evolutionary framework has been valuable for understanding mimivirus biology, as these viruses contain many proteins not typically found in viruses, suggesting complex evolutionary histories and potential novel functions . For uncharacterized proteins like MIMI_R809, evolutionary context can provide vital clues about functional roles and importance.

How might MIMI_R809 research contribute to our understanding of mimivirus biology?

Research on MIMI_R809 has several potential impacts on mimivirus biology understanding:

  • Viral factory organization insights:

    • MIMI_R809 characterization may reveal new components of the viral factory "production line"

    • Understanding its role could clarify the spatiotemporal organization of viral assembly

    • It may contribute to the unique architecture of mimivirus factories observed in electron microscopy studies

  • Virus-host interaction elucidation:

    • If MIMI_R809 interfaces with host components, its study could reveal new host factors required for viral replication

    • This may clarify how mimiviruses repurpose host resources to establish their cytoplasmic factories

  • Evolutionary biology contributions:

    • Functional characterization could provide insights into the evolutionary history of giant viruses

    • It may reveal unexpected relationships to cellular proteins, contributing to debates about viral origins

  • Viral replication mechanisms:

    • Understanding MIMI_R809's role may clarify unique aspects of mimivirus replication

    • This could expand our knowledge beyond the four uncharacterized proteins (L442, L724, L829, and R387) already identified as necessary for mimivirus replication

  • Structural virology advances:

    • Determining MIMI_R809's structure could reveal novel protein folds associated with giant virus biology

    • This may identify new structural motifs involved in viral factory formation

The dynamic nature of mimivirus factories demonstrated through proteomics studies suggests that proteins like MIMI_R809 may have stage-specific functions critical for the remarkable efficiency of these virus-generated organelles.

What are the most promising techniques for determining if MIMI_R809 is essential for viral replication?

To establish whether MIMI_R809 is essential for mimivirus replication, the following methodological approaches are most promising:

  • DNA transfection and microinjection studies:

    • Generate MIMI_R809 deletion mutants in purified viral DNA

    • Microinject the modified DNA into Acanthamoeba cells using established protocols

    • Monitor for successful virion production through microscopy and subculturing

    • Compare with research identifying other essential proteins (L442, L724, L829, R387)

  • CRISPR-Cas9 editing of viral genome:

    • Design guide RNAs targeting MIMI_R809

    • Introduce CRISPR-Cas9 components into infected cells

    • Screen for mutant viruses with altered growth characteristics

    • Verify genetic modifications by sequencing

  • Dominant negative approach:

    • Express mutated versions of MIMI_R809 in host cells

    • Infect with wild-type mimivirus

    • Assess interference with viral replication

    • Monitor viral factory formation using electron microscopy

  • Conditional expression systems:

    • Create mimivirus variants with MIMI_R809 under inducible control

    • Modulate expression during different infection phases

    • Determine critical periods for MIMI_R809 function

    • Correlate with observed viral factory development stages (4h, 5.5h, 7h)

  • Small molecule inhibitors:

    • Develop or identify compounds targeting MIMI_R809

    • Assess dose-dependent effects on viral replication

    • Confirm specificity through resistance mutations

    • Evaluate impacts on viral factory formation and morphology

These approaches can be evaluated through viral production quantification, viral factory morphology assessment using SEM , and comprehensive proteomics analysis of resulting viral particles.

How can contradictory data about MIMI_R809 function be reconciled in research interpretations?

When faced with contradictory data about MIMI_R809 function, researchers should apply this systematic reconciliation framework:

  • Methodological differences analysis:

    • Compare experimental conditions between contradictory studies

    • Evaluate differences in protein preparation (e.g., with/without proteinase K treatment)

    • Consider variations in viral strains or host cell lines

    • Assess sensitivity and specificity of detection methods

  • Temporal context consideration:

    • Determine if contradictions reflect different infection time points

    • Compare with the known dynamic nature of viral factories

    • Consider that protein functions may change throughout infection

    • Analyze if MIMI_R809 behaves like proteins detected in factories but not virions, or vice versa

  • Spatial localization reconciliation:

    • Determine if contradictions reflect different subcellular locations

    • Consider dual localization possibilities

    • Evaluate if modifications occur outside viral factories (as with R135)

    • Integrate with high-resolution microscopy data

  • Post-translational modification assessment:

    • Investigate if contradictions reflect different modification states

    • Consider that some mimivirus proteins undergo glycosylation outside factories

    • Evaluate phosphorylation or other modifications that might alter function

    • Analyze if detection methods recognize all modified forms

  • Functional redundancy evaluation:

    • Assess if contradictions reflect compensatory mechanisms

    • Consider potential functional overlaps with other viral proteins

    • Evaluate if experimental perturbations trigger adaptation

    • Design combinatorial knockout/knockdown studies

This approach recognizes that viral proteins often have context-dependent functions, as demonstrated by the significant differences in protein composition between viral factories at different time points and mature virions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.