Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein R853 (MIMI_R853)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized Protein R853 (MIMI_R853)

Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized Protein R853 (MIMI_R853) is a synthetic protein derived from the genome of Acanthamoeba polyphaga mimivirus (APMV), a giant virus belonging to the Mimiviridae family. While its biological function remains uncharacterized, this protein is part of a broader proteomic landscape of APMV, which includes numerous unannotated genes encoding proteins with potential roles in viral replication, host interaction, or metabolic processes .

2.1. Gene Information

AttributeDescription
Gene NameMIMI_R853
UniProt IDQ5UP28
Genome PositionNot explicitly stated (reliant on genomic annotations)
Protein LengthFull-length (1–129 amino acids)
Source OrganismAcanthamoeba polyphaga mimivirus (APMV)

The protein lacks sequence homology to known functional domains, classifying it as an "ORFan" (open reading frame with no homologs) .

3.1. APMV Proteomic Complexity

APMV encodes over 900 proteins, with ~50% lacking functional annotation . MIMI_R853 exemplifies this category, though structural or biochemical studies remain absent. Comparative analyses of APMV mutants (e.g., strain M4) suggest that uncharacterized proteins like R135, L829, and R387 are critical for virion assembly or host interaction .

3.2. Potential Roles in Viral Replication

While direct evidence for MIMI_R853 is lacking, APMV proteins often participate in:

  • Fiber Formation: Proteins like L442, L724, and L829 are essential for viral surface structures .

  • Metabolic Pathways: APMV encodes enzymes for nucleotide synthesis (e.g., nucleoside diphosphate kinase, NDK) .

  • Host Immune Evasion: Collagen-like proteins (e.g., L71) may modulate host responses .

3.3. Experimental Challenges

  • Functional Annotation: No studies directly link MIMI_R853 to enzymatic activity or structural roles.

  • Expression Context: Recombinant production in E. coli may not replicate native post-translational modifications (e.g., glycosylation) .

4.1. Antibody Development

MIMI_R853 is used in ELISA kits for serological studies, though its clinical relevance remains unexplored .

4.2. Biochemical Studies

  • Purification: Recombinant proteins enable structural analysis via X-ray crystallography or NMR .

  • Interaction Mapping: Co-IP or pull-down assays could identify binding partners in APMV or host cells .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MIMI_R853; Uncharacterized protein R853
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-129
Protein Length
full length protein
Species
Acanthamoeba polyphaga mimivirus (APMV)
Target Names
MIMI_R853
Target Protein Sequence
MYEDAIDFDDPYLFHSVISPQLNSGLITPRYVLDKVIDKYNKSNTDLLYEVEGYIRQLVW REYSRMLYRYIRKDMMKNYFGNKNRISEIWYTGNTGIEPVDLAISSAFQYGLSTSNFFFI FLYIFTIKI
Uniprot No.

Target Background

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is known about the basic properties of MIMI_R853?

MIMI_R853 is an uncharacterized protein from Acanthamoeba polyphaga mimivirus (APMV). The full-length protein consists of 129 amino acids, and recombinant versions are typically produced with a His-tag in E. coli expression systems . As an uncharacterized protein, its biological function, structural properties, and role in viral replication remain largely unknown. Current databases show minimal information regarding its pathway involvement, biochemical functions, or protein interactions, indicating significant research opportunities in these areas .

How does MIMI_R853 fit within the context of the Acanthamoeba polyphaga mimivirus genome?

MIMI_R853 is one of many genes in the large mosaic genome of Acanthamoeba polyphaga mimivirus. Mimiviruses possess exceptionally large genomes among viruses, with significant mosaicism resulting from their close proximity to other microorganisms within Acanthamoeba hosts . Research suggests that the sympatric lifestyle of mimiviruses within amoebae creates opportunities for extensive horizontal gene transfer, contributing to their genomic complexity . When investigating MIMI_R853, it's essential to consider this genomic context and the possibility that this protein may have originated from gene exchange events between the virus and its amoebal host or other microorganisms.

What approaches are recommended for initial characterization of an uncharacterized viral protein like MIMI_R853?

Initial characterization should employ a multi-faceted approach:

  • Sequence analysis: Begin with bioinformatic analysis including:

    • Multiple sequence alignments with potential homologs

    • Domain prediction to identify functional motifs

    • Secondary structure prediction

    • Disorder prediction to identify structured regions

  • Recombinant protein expression and purification: Express the full-length protein with affinity tags (typically His-tags) for purification . For MIMI_R853, using both N- and C-terminal tags can help distinguish between full-length protein and truncated products during purification .

  • Biochemical characterization: Assess basic properties such as:

    • Molecular weight confirmation via SDS-PAGE

    • Oligomerization state using size exclusion chromatography

    • Stability studies under different pH and temperature conditions

    • Preliminary activity assays based on predicted functions

These methods establish a foundation for more targeted functional investigations.

What are the optimal expression systems for recombinant MIMI_R853 production?

While E. coli is the most commonly used expression system for MIMI_R853 , researchers should consider several factors when selecting an expression system:

  • Prokaryotic systems (E. coli):

    • Advantages: Rapid growth, high yield, cost-effective, and straightforward genetic manipulation

    • Challenges: May face issues with protein folding, solubility, and post-translational modifications

    • Optimization strategies: Use specialized strains (BL21(DE3), Rosetta for rare codons), fusion partners (SUMO, MBP, GST), and controlled expression conditions (reduced temperature, IPTG concentration)

  • Eukaryotic alternatives:

    • Insect cells: Better for complex viral proteins requiring eukaryotic folding machinery

    • Yeast: Balances higher eukaryotic processing capability with reasonable costs

    • Mammalian cells: Consider for studies requiring authentic post-translational modifications

For MIMI_R853 specifically, E. coli expression has been documented to yield full-length protein , but expression optimization may be necessary depending on research requirements.

What purification challenges are commonly encountered with MIMI_R853, and how can they be addressed?

Common purification challenges for viral proteins like MIMI_R853 include:

  • Truncated products:

    • Challenge: Proteolysis or improper translation initiation leading to incomplete proteins

    • Solution: Use dual-tagged constructs (N- and C-terminal tags) and optimize elution conditions with increased imidazole concentration to select for full-length protein

  • Solubility issues:

    • Challenge: Formation of inclusion bodies due to misfolding

    • Solutions: Optimize expression temperature (typically lower temperatures, 16-18°C), use solubility-enhancing fusion partners, or develop refolding protocols from inclusion bodies

  • Protein stability:

    • Challenge: Degradation during purification

    • Solutions: Include protease inhibitors, minimize purification time, optimize buffer conditions based on stability studies

  • Purity requirements:

    • Challenge: Contaminating proteins affecting downstream analyses

    • Solution: Implement multi-step purification strategies combining affinity chromatography with size exclusion and/or ion exchange methods

Each purification strategy should be empirically optimized based on the specific research objectives and downstream applications.

What techniques are most suitable for determining the structure of MIMI_R853?

Multiple complementary approaches should be considered for structural characterization:

The choice of method depends on research objectives, available resources, and protein properties.

How can computational approaches complement experimental methods in understanding MIMI_R853 structure?

Computational approaches provide valuable insights, especially for uncharacterized proteins like MIMI_R853:

  • Homology modeling:

    • Methodology: Identify structural templates using sensitive sequence comparison tools (HHpred, PHYRE2)

    • Limitations: Accuracy depends on sequence similarity to proteins of known structure

    • Validation: Use multiple modeling algorithms and assess model quality with PROCHECK, VERIFY3D

  • Ab initio modeling:

    • Applications: When no suitable structural templates exist

    • Tools: Rosetta, QUARK, AlphaFold2

    • Considerations: Results should be experimentally validated

  • Molecular dynamics simulations:

    • Applications: Study protein flexibility, conformational changes, and potential binding sites

    • Insights: Dynamic behavior not captured by static structures

    • Requirements: Computational resources for adequate sampling

  • Structure-based function prediction:

    • Tools: ProFunc, COACH, 3DLigandSite

    • Applications: Identify potential binding pockets, active sites, or functional residues

Computational predictions should inform experimental design and be refined based on experimental results in an iterative process.

What approaches can be used to investigate potential functions of MIMI_R853?

For uncharacterized proteins like MIMI_R853, a systematic multi-omics approach is recommended:

  • Transcriptomic analysis:

    • Methodology: RNA-seq during viral infection to determine expression timing

    • Insights: Temporal expression patterns may indicate functional roles in specific infection stages

  • Proteomic strategies:

    • Affinity purification-mass spectrometry (AP-MS): Identify protein interaction partners

    • Proximity labeling (BioID, APEX): Map proximal proteins in cellular context

    • Crosslinking mass spectrometry (XL-MS): Identify direct protein-protein interactions

  • Genetic approaches:

    • Gene knockout/knockdown: Assess phenotypic changes in viral replication

    • Complementation studies: Restore function after knockout

    • Site-directed mutagenesis: Identify essential residues

  • Biochemical activity assays:

    • Systematic screening for enzymatic activities (nuclease, protease, etc.)

    • DNA/RNA binding assays (EMSA, filter binding)

    • Lipid binding assays

  • Cell-based functional assays:

    • Cellular localization studies using fluorescently tagged proteins

    • Impact on host cell processes (cell cycle, apoptosis, etc.)

    • Effect on host immune response

These approaches should be guided by bioinformatic predictions and applied iteratively as preliminary findings direct subsequent experiments.

How can researchers investigate potential roles of MIMI_R853 in mimivirus-host interactions?

Investigating host-pathogen interactions involving MIMI_R853 requires specialized approaches:

  • Infection models:

    • Acanthamoeba cultures infected with wild-type and MIMI_R853-mutant mimiviruses

    • Time-course analysis of infection progression

    • Comparative proteomics of host cells during infection

  • Localization studies:

    • Immunofluorescence microscopy to track protein location during infection

    • Subcellular fractionation and western blotting

    • Live-cell imaging with fluorescently tagged proteins

  • Host response analysis:

    • Transcriptomic profiling of host cells with and without MIMI_R853 expression

    • Phosphoproteomics to identify altered signaling pathways

    • Analysis of cytoskeletal changes or membrane modifications

  • Interspecies protein interaction mapping:

    • Yeast two-hybrid screening against host protein libraries

    • Pull-down assays with host cell lysates

    • Protein complementation assays in heterologous systems

  • Structural studies of host-viral protein complexes:

    • Co-crystallization attempts with identified host partners

    • Crosslinking mass spectrometry to map interaction interfaces

    • Hydrogen-deuterium exchange mass spectrometry for binding site identification

Research should acknowledge the complex ecological context in which mimiviruses interact with amoeba hosts in the presence of other microorganisms .

How can phylogenetic analysis help understand the evolutionary history of MIMI_R853?

Phylogenetic analysis provides critical insights into the origin and evolution of viral proteins:

  • Sequence-based phylogenetic reconstruction:

    • Methodology:

      • Identify homologs using sensitive sequence search tools (PSI-BLAST, HHpred)

      • Perform multiple sequence alignment

      • Construct phylogenetic trees using maximum likelihood or Bayesian methods

    • Interpretation: Tree topology can reveal evolutionary relationships and potential horizontal gene transfer events

  • Comparative genomic context analysis:

    • Examine gene neighborhood conservation across viral genomes

    • Identify syntenic regions and gene clusters

    • Assess correlation with other phylogenetic patterns

  • Ancestral sequence reconstruction:

    • Methodology: Infer ancestral protein sequences at internal tree nodes

    • Applications: Understand evolutionary trajectories and functional shifts

    • Tools: FastTree, MEGA6 (as mentioned in the literature for capsid protein analysis)

  • Selection pressure analysis:

    • Calculate dN/dS ratios to identify sites under purifying or positive selection

    • Infer functional constraints or adaptive evolution

These analyses can reveal whether MIMI_R853 has been conserved through vertical inheritance or acquired through horizontal gene transfer, providing insights into its functional importance.

What evidence exists for potential horizontal gene transfer involving MIMI_R853?

Research on Acanthamoeba-mimivirus interactions has identified extensive horizontal gene transfer (HGT), which may apply to MIMI_R853:

  • Host-virus gene exchange patterns:

    • The literature reports 366 genes in A. polyphaga that could have been exchanged with viruses

    • The sympatric lifestyle of various microorganisms within Acanthamoeba creates opportunities for gene trafficking

  • Methodological approach to identify HGT:

    • Perform similarity searches (BLASTp, tBLASTn) between viral ORFs and host genomes

    • Apply criteria such as percent identity ≥30%, e-value ≤1e-2, coverage ≥30%

    • Create networks of gene trafficking using tools like Cytoscape

  • Mosaic gene analysis:

    • Analyze MIMI_R853 using a "fenestration" approach (sliding window analysis of 40 amino acids with 20 amino acid steps)

    • Visualize gene mosaicism using tools like Circos

    • Compare results with transcriptome data to assess functional significance

  • Comparative analysis across Acanthamoeba species:

    • Examine presence/absence patterns of MIMI_R853 homologs across different Acanthamoeba species

    • Assess synteny and conservation of genomic regions harboring viral-related genes

Research has shown that culturing Mimivirus in ARM-free Acanthamoeba led to a 16% reduction of the viral genome after 100 passages, highlighting the dynamic nature of viral genomes in the absence of gene exchange opportunities .

How might MIMI_R853 contribute to mimivirus replication strategies?

Understanding MIMI_R853's potential role in viral replication requires integrating multiple experimental approaches:

  • Temporal expression analysis:

    • Methodology: Time-course RT-qPCR or RNA-seq during infection

    • Research question: Is MIMI_R853 expressed early, intermediate, or late in infection?

    • Interpretation: Early genes often function in host takeover, while late genes may be structural or involved in virion assembly

  • Localization during viral factory formation:

    • Methodology: Immunofluorescence microscopy with antibodies against MIMI_R853

    • Research question: Does MIMI_R853 localize to viral factories, virions, or host structures?

    • Significance: Localization provides functional clues (structural proteins in virions, replication proteins in factories)

  • Protein-protein interaction network:

    • Methodology: Affinity purification-mass spectrometry at different infection stages

    • Research question: What viral and host proteins interact with MIMI_R853?

    • Analysis: Integration with temporal and spatial data to build functional hypotheses

  • Genetic manipulation studies:

    • Methodology: CRISPR-based genome editing of the mimivirus genome to knock out or modify MIMI_R853

    • Research question: Is MIMI_R853 essential for viral replication? What phenotypic changes occur upon mutation?

    • Controls: Complementation studies to confirm specificity of observed effects

  • Functional domain mapping:

    • Methodology: Truncation and point mutation analysis

    • Research question: Which regions/residues are critical for function?

    • Applications: Structure-function relationships and mechanism elucidation

These approaches can reveal whether MIMI_R853 functions in processes such as viral DNA replication, transcription, translation modulation, viral factory formation, or virion assembly.

What methodological approaches can address contradictory data when studying MIMI_R853?

When facing contradictory results in MIMI_R853 research:

  • Systematic validation across multiple systems:

    • Test in different expression systems (bacterial, insect, mammalian)

    • Compare results in different Acanthamoeba species (A. polyphaga, A. castellanii)

    • Control for variations in experimental conditions (temperature, pH, buffers)

  • Reproducibility assessment:

    • Implement blinded experimental designs

    • Use multiple independent methods to test the same hypothesis

    • Perform biological and technical replicates with appropriate statistical analysis

  • Addressing context-dependency:

    • Test functions under different physiological conditions

    • Examine protein behavior in different cellular compartments

    • Consider temporal factors in infection cycle

  • Resolution through structural biology:

    • Determine if contradictory functions map to different structural domains

    • Characterize conformational changes that might explain different activities

    • Solve structures of protein complexes to understand context-specific functions

  • Integration of multi-omics data:

    • Combine transcriptomics, proteomics, and metabolomics data

    • Use network analysis to place contradictory findings in broader context

    • Develop computational models that account for seemingly contradictory observations

When publishing, researchers should transparently report contradictory results and proposed resolutions rather than selectively reporting supportive data.

What controls are essential when designing experiments to study MIMI_R853?

Robust experimental design requires appropriate controls:

  • Recombinant protein studies:

    • Positive controls: Well-characterized proteins with similar properties or domains

    • Negative controls: Inactive mutants (e.g., catalytic site mutations for enzymes)

    • Tag-only controls: Empty vector expressing only the affinity tag

    • Storage controls: Tests for activity retention after various storage conditions

  • Interaction studies:

    • Bait-only controls in pull-down experiments

    • Competition assays with unlabeled protein

    • Reverse pull-downs (target as bait instead of prey)

    • Randomized or scrambled protein controls

  • Functional assays:

    • Dose-response relationships to establish specificity

    • Kinetic measurements with appropriate enzyme kinetics models

    • Inhibitor studies with structurally related but functionally distinct compounds

    • Host cell type controls (different Acanthamoeba species have different permissivity to mimiviruses)

  • Localization studies:

    • Multiple fixation and permeabilization methods

    • Comparison of different tagging strategies (N-terminal vs. C-terminal)

    • Co-localization with known markers of cellular compartments

    • Live-cell vs. fixed-cell imaging comparisons

  • Infection studies:

    • Mock infections

    • UV-inactivated virus controls

    • Time-matched uninfected controls

    • Infections with related viruses to assess specificity

Implementing these controls helps distinguish true biological effects from technical artifacts.

How can researchers overcome expression and purification challenges specific to MIMI_R853?

For challenging viral proteins like MIMI_R853:

  • Expression optimization strategies:

    • Codon optimization for the expression host

    • Systematic testing of expression temperatures (37°C, 30°C, 18°C)

    • Induction protocol optimization (IPTG concentration, induction timing)

    • Auto-induction media to avoid toxicity issues

    • Expression screening in multiple E. coli strains (BL21(DE3), Rosetta, Arctic Express)

  • Solubility enhancement approaches:

    • Fusion partners (SUMO, MBP, GST) with specific cleavage sites

    • Co-expression with chaperones (GroEL/GroES, DnaK/DnaJ)

    • Lysis buffer optimization (detergents, salt concentration, reducing agents)

    • On-column refolding techniques

  • Purification troubleshooting:

    • Address truncation issues using dual-tagging strategies

    • Optimize imidazole concentration in elution buffers to distinguish full-length from truncated products

    • Implement multi-step purification combining affinity, ion exchange, and size exclusion methods

    • Stability screening using differential scanning fluorimetry to identify optimal buffer conditions

  • Protein quality assessment:

    • Dynamic light scattering to assess homogeneity

    • Size exclusion chromatography with multi-angle light scattering (SEC-MALS) for accurate molecular weight determination

    • Mass spectrometry to confirm intact mass and post-translational modifications

These methodological considerations can significantly improve the quality and yield of purified MIMI_R853 protein for downstream applications.

What are the most significant knowledge gaps regarding MIMI_R853?

Current research on MIMI_R853 reveals several critical knowledge gaps:

  • Functional characterization:

    • The biochemical function remains entirely unknown with empty function tables in database entries

    • No confirmed pathway associations or enzymatic activities have been established

    • Protein interaction partners have not been identified

  • Structural information:

    • No three-dimensional structure is available

    • Secondary structure elements and functional domains remain uncharacterized

    • Structural homology to proteins of known function has not been established

  • Evolutionary context:

    • Origin of MIMI_R853 (vertical inheritance vs. horizontal gene transfer) is undetermined

    • Conservation across different mimivirus strains is not well-documented

    • Potential homologs in other giant viruses or host organisms require investigation

  • Role in viral life cycle:

    • Expression timing during infection is unknown

    • Localization during viral replication has not been determined

    • Contribution to viral fitness or host range has not been assessed

These gaps highlight the preliminary state of knowledge about this uncharacterized protein and suggest multiple avenues for future research.

What interdisciplinary approaches might accelerate understanding of MIMI_R853?

Addressing the complex nature of MIMI_R853 requires integrated approaches:

  • Structural biology and bioinformatics integration:

    • Combine experimental structure determination with computational modeling

    • Apply machine learning approaches for function prediction from structure

    • Use molecular dynamics simulations to identify potential binding sites

  • Systems virology:

    • Network analysis of protein-protein interactions during infection

    • Integration of transcriptomics, proteomics, and metabolomics data

    • Mathematical modeling of viral factory development with and without MIMI_R853

  • Evolutionary biology and comparative genomics:

    • Apply phylogenetic approaches to understand protein evolution

    • Compare genomic context across diverse giant viruses

    • Examine host-virus coevolution patterns

  • Host-pathogen interaction studies:

    • Investigate impacts on host cell processes using cell biology approaches

    • Assess effects on host immune responses

    • Examine ecological implications in environmental samples

  • Synthetic biology approaches:

    • Design minimal mimivirus genomes to test essentiality

    • Engineer chimeric proteins to test domain functions

    • Develop biosensors for detecting protein activity in living cells

By combining these interdisciplinary approaches, researchers can develop a comprehensive understanding of MIMI_R853's role in mimivirus biology and potential applications in biotechnology or therapeutic development.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.