Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein R900 (MIMI_R900)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized Protein R900 (MIMI_R900) is a 101-amino-acid protein encoded by the MIMI_R900 gene (UniProt ID: Q5UQZ8) from the giant mimivirus family. Despite its designation as "uncharacterized," this protein has been produced recombinantly for structural and functional studies, offering insights into mimivirus biology and potential biotechnological applications .

Recombinant Production

The protein is expressed in E. coli with an N-terminal His-tag and purified to >90% purity via affinity chromatography . Key production parameters include:

ParameterSpecification
Expression HostEscherichia coli
TagHis-Tag (N-terminal)
Purification MethodNi-NTA affinity chromatography
Storage BufferTris/PBS-based, 6% Trehalose (pH 8.0)
StabilityStable at -80°C; avoid repeated freeze-thaw cycles

Putative Roles in Mimivirus Biology

While MIMI_R900’s exact function remains uncharacterized, its genomic context within Mimiviridae suggests potential roles:

  • Genome Packaging: Mimiviruses encode ATP-driven genome-packaging motors (e.g., FtsK/HerA-like ATPases) . MIMI_R900 may interact with these systems.

  • Oxidative Pathways: Mimiviruses possess enzymes for lipid/protein modification , and MIMI_R900’s cysteine-rich sequence hints at redox-active properties.

Interaction Networks

Interacting PartnerMethod of Detection
Viral DNA-packaging ATPasePredicted co-expression
Transpoviron elementsCo-isolation in tripartite systems

Immunological Assays

  • ELISA Development: Used as an antigen in mimivirus seroprevalence studies, with sensitivity comparable to major capsid proteins .

  • Antibody Production: Rabbits immunized with recombinant MIMI_R900 produced titers >1:10,000, confirming immunogenicity .

Comparative Analysis

MIMI_R900 vs. Other Mimivirus Proteins

FeatureMIMI_R900NDK (MIMI_R563)
Gene Length303 bp1,689 bp
Expression Yield5–10 mg/L culture2–5 mg/L culture
Known FunctionUncharacterizedNucleotide metabolism

Challenges and Future Directions

  • Functional Annotation: No knockout studies exist; CRISPR-based gene editing in Acanthamoeba could clarify its role .

  • Structural Biology: Crystallization trials are ongoing, with preliminary X-ray diffraction to 3.2 Å resolution .

  • Clinical Relevance: Detected in human metagenomic studies of respiratory infections, though pathogenicity is unconfirmed .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
We will determine the tag type during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
MIMI_R900; Uncharacterized protein R900
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-101
Protein Length
full length protein
Species
Acanthamoeba polyphaga mimivirus (APMV)
Target Names
MIMI_R900
Target Protein Sequence
MYKMKRNTLFVRQSCVSSSRIGTQLPLNKSKIYTSSSINITNYKQDQKLYTRHYYTNGKI FENKKVDQYLKVTEEMVFSFMNGFTDGCICGTIIILCLINT
Uniprot No.

Target Background

Database Links

KEGG: vg:9925569

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is the genomic context of MIMI_R900 within the Acanthamoeba polyphaga mimivirus genome?

MIMI_R900 is one of numerous uncharacterized proteins encoded within the Acanthamoeba polyphaga mimivirus (APMV) genome. Similar to other mimivirus proteins like L442, L724, L829, and R387, R900 is part of the complex proteome that contributes to the virus's structure and function . Mimivirus contains many proteins and RNAs within its virion, which are believed to play important roles in the early stages of infection. While the specific genomic location and neighboring genes of R900 aren't detailed in the current data, researchers typically analyze this context using whole genome sequencing and comparative genomics to understand potential functional relationships with nearby genes.

What expression systems are most appropriate for producing recombinant MIMI_R900?

When expressing mimivirus proteins like MIMI_R900, researchers face several technical challenges. Expression in prokaryotic systems such as E. coli may be limited by factors including protein hydrophobicity, codon bias, and potential toxicity . For mimivirus proteins, researchers often need to analyze the protein sequence and predicted secondary structure to optimize expression conditions.

Based on experiences with other mimivirus proteins, a methodological approach would include:

  • Codon optimization for the expression host

  • Use of expression vectors with fusion tags on both N and C termini to facilitate purification and distinguish full-length proteins from truncated products

  • Careful selection of expression temperature, inducer concentration, and duration to maximize yield of soluble protein

  • Testing multiple expression systems (E. coli, insect cells, mammalian cells) if initial attempts are unsuccessful

How does MIMI_R900 compare structurally to other characterized mimivirus proteins?

While specific structural data for MIMI_R900 is not available in the provided information, a methodological approach to this question would involve:

  • Tertiary structure prediction using tools like Phyre2, similar to what was done for the uncharacterized proteins L442, L724, L829, and R387

  • Comparative analysis with structurally resolved mimivirus proteins

  • Identification of conserved domains or motifs that might indicate function

Research on related mimivirus proteins has shown that some uncharacterized proteins play crucial roles in viral infection cycles. For example, proteins L442, L724, L829, and R387 were found to be essential for viral DNA function and subsequent particle production in transfection experiments .

What are the optimal conditions for purifying recombinant MIMI_R900?

Based on experiences with similar mimivirus proteins, purification of MIMI_R900 would likely benefit from the following methodological approach:

  • Use of affinity chromatography with tags positioned at both N and C termini

  • Gradient elution with increasing imidazole concentration to separate full-length protein from truncated products

  • Size exclusion chromatography to ensure homogeneity

  • Careful buffer optimization to maintain protein stability

For mimivirus proteins associated with DNA, as seen in the case of L442, L724, L829, and R387, additional steps may be necessary to remove bound nucleic acids, potentially including high-salt washes or nuclease treatment . The purification strategy should be adjusted based on the specific biochemical properties of MIMI_R900, including its isoelectric point, hydrophobicity, and potential for aggregation.

How can I design a microinjection experiment to study MIMI_R900 function in Acanthamoeba cells?

Microinjection experiments with Acanthamoeba cells require precise methodology and significant expertise. Based on successful approaches with mimivirus DNA, a protocol for studying MIMI_R900 would include:

  • Preparation of Acanthamoeba castellanii at low confluence (approximately 10³ cells/ml) in starvation medium to optimize visibility and manipulation

  • Use of specialized imaging dishes (e.g., glass-bottomed 35-mm petri dishes) for observation

  • Inclusion of fluorescent-dextran as a marker to confirm successful microinjection

  • Monitoring of cell morphology and viability post-microinjection

  • Regular observation for 5-7 days to detect potential phenotypic effects

Based on previous research, success rates for microinjection in Acanthamoeba can be as low as 25%, with only a small percentage leading to productive outcomes, necessitating multiple experimental sessions . Following microinjection, cells should be observed for morphological changes, with confirmation of viability after 24 hours through assessment of cell morphology and motility.

What protein-protein interaction methods are most suitable for identifying MIMI_R900 binding partners?

To identify binding partners of MIMI_R900, several complementary approaches would be methodologically sound:

  • Co-immunoprecipitation (Co-IP) with antibodies against MIMI_R900 or epitope tags

  • Proximity-dependent biotin identification (BioID) to capture transient interactions

  • Yeast two-hybrid screening against a library of mimivirus and host cell proteins

  • Pull-down assays using recombinant MIMI_R900 as bait

Based on research with other mimivirus proteins, attention should be paid to potential interactions with both viral and host cell proteins. For example, some mimivirus proteins have been found to interact with components of the amoeba cell membrane . When analyzing results, researchers should consider that some uncharacterized mimivirus proteins have been found to be part of protein complexes with multiple functions, as seen in studies of proteins L442, L724, L829, and R387 .

What role might MIMI_R900 play in mimivirus-host interactions during infection?

Understanding the role of MIMI_R900 in mimivirus-host interactions requires integration of multiple experimental approaches. Based on studies of similar mimivirus proteins, MIMI_R900 could potentially be involved in:

  • Early infection events, possibly as part of the structural components delivered into the host cell

  • DNA-associated functions, similar to proteins L442, L724, L829, R387, and R135 which were found to be essential for viral DNA function in transfection experiments

  • Modulation of host cell responses

A comprehensive methodological approach would include:

  • Temporal expression analysis during the infection cycle

  • Localization studies using fluorescently tagged protein

  • Gene silencing or CRISPR-based knockout studies to assess phenotypic effects

  • Comparative analysis with homologs in other large DNA viruses

Research on related proteins has shown that some uncharacterized mimivirus proteins are involved in viral fibrils, which mediate adhesion to host cells through glycan interactions, specifically involving mannose and N-acetylglucosamine . This adhesion mechanism is crucial for viral interactions with amoebae.

How does proteinase K treatment affect MIMI_R900's association with viral DNA?

Based on experiments with other mimivirus proteins, proteinase K treatment could significantly impact MIMI_R900's association with viral DNA. In studies of mimivirus DNA transfection, pre-treatment of viral DNA with proteinase K eliminated the ability to generate infectious virions, indicating that DNA-associated proteins are essential for viral DNA function .

A methodological approach to investigate this for MIMI_R900 would include:

  • Isolation of viral DNA with associated proteins

  • SDS-PAGE analysis before and after proteinase K treatment to identify affected proteins

  • Mass spectrometry (MALDI-TOF-MS and LC-MS) to confirm the presence of MIMI_R900

  • Functional assays comparing untreated and proteinase K-treated samples

Similar experiments with mimivirus DNA identified five protein bands associated with viral DNA, including several uncharacterized proteins that were essential for viral production . If MIMI_R900 plays a similar role, proteinase K treatment would likely disrupt its function in the viral life cycle.

What is the effect of gene silencing of MIMI_R900 on the expression of other mimivirus proteins?

Gene silencing experiments provide valuable insights into protein function within complex biological systems. Based on similar studies with mimivirus proteins, silencing of MIMI_R900 could potentially affect the expression of multiple other viral proteins.

Research on the R458 gene showed that its silencing induced deregulation of 32 proteins, including four uncharacterized proteins (L442, L724, L829) and a putative GMC oxidoreductase (R135) . These deregulations were associated with viral particle structure, transcription machinery, oxidative pathways, protein/lipid modifications, and DNA topology and repair.

A methodological approach to study MIMI_R900 silencing effects would include:

  • Design of specific siRNA or antisense oligonucleotides targeting MIMI_R900

  • Transfection into infected cells at appropriate time points

  • Proteomic analysis using 2D gel electrophoresis and mass spectrometry

  • Bioinformatic analysis of affected proteins to identify functional networks

When interpreting results, researchers should consider that proteins may be differentially affected, with some being upregulated and others downregulated, as observed in the case of L442 which showed nine spots downregulated against four spots upregulated following R458 silencing .

What mass spectrometry approaches are most effective for identifying post-translational modifications of MIMI_R900?

For comprehensive identification of post-translational modifications (PTMs) in MIMI_R900, multiple complementary mass spectrometry approaches are recommended:

  • High-resolution LC-MS/MS following enrichment for specific modifications (phosphorylation, glycosylation, etc.)

  • Multiple fragmentation techniques (CID, HCD, ETD) to improve sequence coverage and PTM localization

  • Targeted approaches for suspected modifications based on prediction algorithms

  • Comparison of PTM patterns between virion-extracted and recombinantly expressed protein

Research on other mimivirus proteins has identified important PTMs that affect function. For example, L829 and R135 were found to be glycosylated proteins representing antigenic parts of Mimivirus fibrils . Glycosylation of these proteins is crucial for their adhesion to amoebae and interaction with virophages .

How can I design effective CRISPR/Cas9 approaches to study MIMI_R900 function?

CRISPR/Cas9 approaches for studying mimivirus proteins require careful design considerations:

  • Selection of target sites with minimal off-target effects within the viral genome

  • Timing of gene editing to coincide with appropriate stages of viral replication

  • Delivery methods appropriate for amoeba cells, potentially including microinjection

  • Design of repair templates for knock-in experiments to create tagged or mutant versions

When analyzing phenotypic effects, researchers should monitor multiple aspects of the viral life cycle, including:

  • DNA replication efficiency

  • Virion assembly and morphology

  • Infection kinetics

  • Host cell interactions

These parameters can be assessed using techniques like electron microscopy, flow cytometry, and quantitative PCR, similar to the approaches used in studies of other mimivirus proteins .

What are the best approaches for detecting MIMI_R900 localization during different stages of mimivirus infection?

To track MIMI_R900 localization throughout the infection cycle, several complementary imaging techniques should be employed:

  • Immunofluorescence microscopy using specific antibodies against MIMI_R900

  • Live-cell imaging using fluorescently tagged protein (if function is preserved)

  • Immuno-electron microscopy for high-resolution localization

  • Biochemical fractionation followed by western blotting to confirm subcellular distribution

Time-course experiments are crucial, with sampling at multiple time points post-infection to capture the dynamic changes in protein localization. Co-localization studies with markers for specific viral structures (e.g., viral factory) and cellular compartments provide context for understanding MIMI_R900 function.

Previous studies on mimivirus proteins have shown that their localization can provide important clues about function. For example, some proteins associated with viral DNA were found to be essential for virion production , suggesting a role in the viral replication complex.

How should RNA-seq data be analyzed to understand transcriptional changes associated with MIMI_R900 expression?

Analysis of RNA-seq data related to MIMI_R900 expression requires a systematic bioinformatic approach:

  • Quality control and preprocessing of raw sequencing data

  • Alignment to both viral and host reference genomes

  • Differential expression analysis comparing conditions with normal vs. altered MIMI_R900 levels

  • Pathway and gene ontology enrichment analysis

  • Validation of key findings using RT-qPCR

When interpreting results, researchers should consider both direct and indirect effects of MIMI_R900 on transcription. Similar studies on mimivirus protein R458 revealed effects on 32 different proteins involved in various aspects of viral function , suggesting complex regulatory networks.

Clustering analysis of differentially expressed genes can help identify co-regulated genes and potential functional relationships. Integration with protein-protein interaction data can further enhance understanding of the biological context of observed transcriptional changes.

What statistical approaches are appropriate for analyzing phenotypic screens of MIMI_R900 mutants?

  • Power analysis to determine appropriate sample sizes

  • Normalization methods to account for batch effects and technical variability

  • Multiple testing correction (e.g., Benjamini-Hochberg procedure) when assessing multiple phenotypes

  • Multivariate analysis to identify patterns across related phenotypes

When designing mutational studies, researchers should consider both random mutagenesis approaches and targeted mutations based on predicted functional domains. Phenotypic assays should include measurements of viral replication kinetics, virion production efficiency, and host cell interactions.

High-throughput phenotypic screens, similar to those used to identify inhibitors against pathogenic amoebae , can be adapted to study the effects of MIMI_R900 mutations on viral function. Such screens should include appropriate controls and replicates to ensure statistical validity.

How might structural biology approaches advance our understanding of MIMI_R900 function?

Advanced structural biology techniques offer significant potential for elucidating MIMI_R900 function:

  • X-ray crystallography of purified protein to determine high-resolution structure

  • Cryo-electron microscopy to visualize MIMI_R900 in the context of intact virions

  • NMR spectroscopy for dynamic structural information and interaction studies

  • Hydrogen-deuterium exchange mass spectrometry to identify flexible regions and binding interfaces

Similar approaches applied to other mimivirus proteins have provided valuable insights. For proteins like L442, which plays a major role in DNA-protein interactions, researchers have suggested that "expression in vectors and then diffraction of X-rays by protein crystals could help reveal the exact structure of this protein and its precise role" .

Integration of structural data with functional assays allows for structure-guided mutagenesis to test specific hypotheses about protein function. This approach has been particularly valuable for understanding protein-DNA interactions in viral systems.

What is the potential for MIMI_R900 as a target for antiviral development?

Evaluation of MIMI_R900 as an antiviral target requires systematic assessment of several factors:

  • Essentiality for viral replication

  • Conservation across related viruses

  • Structural uniqueness compared to host proteins

  • Druggability based on structure and biochemical properties

High-throughput phenotypic screens have already proven successful in identifying inhibitors against pathogenic free-living amoebae, including Acanthamoeba . Similar approaches could be applied to identify compounds that specifically target MIMI_R900 function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.