Recombinant Acaryochloris marina Apocytochrome f (petA)

Shipped with Ice Packs
In Stock

Description

Introduction to Acaryochloris marina and its Photosynthetic System

Acaryochloris marina is a unique marine cyanobacterium notable for its capacity to perform oxygenic photosynthesis utilizing far-red light . This adaptation is enabled by its distinctive photosynthetic pigments, particularly chlorophyll d, which absorbs light at longer wavelengths than chlorophyll a, the pigment typically found in other cyanobacteria and plants . Unlike most cyanobacteria, many Acaryochloris strains lack phycobiliproteins (PBPs), photosynthetic antennae that capture light energy, though the type strain A. marina MBIC11017 retains PBP due to horizontal gene transfer (HGT) .

The Role of Cytochrome f (petA) in Photosynthesis

Cytochrome f, encoded by the petA gene, is a crucial component of the cytochrome b6-f complex . This complex mediates electron transfer between Photosystem II (PSII) and Photosystem I (PSI) in the photosynthetic electron transport chain . The cytochrome b6-f complex is essential for generating the proton gradient across the thylakoid membrane, which drives ATP synthesis .

Photosystem I (PSI) Structure and Function in A. marina

The PSI reaction center in A. marina has a unique structure, as revealed by cryo-electron microscopy at 2.58 Å resolution . It comprises 11 subunits with an arrangement of electron carriers and light-harvesting pigments that differs from other type I reaction centers . The special pair, known as P740, consists of a dimer of chlorophyll d and its epimer chlorophyll d' . The primary electron acceptor is pheophytin a, a metal-less chlorin . The important assigned cofactors involved in electron transfer are four Chls, two Pheos, two PhyQs (A1), and three iron–sulfur clusters (FX, FA, and FB) .

Evolutionary and Genomic Insights

Genomic analysis of Acaryochloris strains reveals a dynamic evolutionary history marked by gene gain and loss . Horizontal gene transfer (HGT) has played a significant role in the evolution of new functions, such as the reacquisition of phycobiliproteins (PBPs) in certain strains . Comparative genomics between different A. marina strains, such as MBIC11017 and MBIC10699, highlights the diversity in plasmid-encoded genes and changes in photosystem genes during evolution .

Potential Applications and Further Research

Understanding the photosynthetic mechanisms of Acaryochloris marina can provide insights for bioengineering and biotechnological applications. The ability to efficiently use far-red light may be valuable in developing new strategies for:

  • Optimizing photosynthetic efficiency in artificial systems.

  • Engineering crops that can grow under low-light conditions.

  • Developing new sources of biofuels and other bioproducts.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
petA; AM1_4449; Cytochrome f
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
37-315
Protein Length
Full Length of Mature Protein
Species
Acaryochloris marina (strain MBIC 11017)
Target Names
petA
Target Protein Sequence
FPIYAQQAYDSPREANGRIVCANCHLAAKPTQVEVPQAVLPDTVFEAVIKIPYDTDAQQV LGSGDLGPLNVGAVLMLPDGFQIAPDDRIPEKMKEEINGVFYQKYKPDTDNVIVVGPLSG ADHQEIIFPVLSPDPATDPNIHFGKYSVHAGGNRGRGQIYPTGDKTNVNAVTSPAAGLVS SVSENSVTITTNDGQTVTESIPAGLEVVVSEGQAVADGAPLSSDPNVGGFGQKDTEIVLQ SGTRIKWLMVFFSAIMISQTLLVLKKKQVEKVQAAEMNF
Uniprot No.

Target Background

Function

Component of the cytochrome b6-f complex. This complex facilitates electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions.

Database Links
Protein Families
Cytochrome f family
Subcellular Location
Cellular thylakoid membrane; Single-pass membrane protein.

Q&A

What is Acaryochloris marina and why is it significant for photosynthesis research?

Acaryochloris marina is a unique cyanobacterium that uses chlorophyll d as its primary photosynthetic pigment (>90% of chlorophyll content), allowing it to efficiently utilize far-red light for photosynthesis. Originally discovered off the coast of Central California by Manning and Strain in 1943, A. marina has adapted to marine environments enriched in far-red light . Its photosynthetic system has unique modifications that enable it to exploit niche environments where visible light is depleted and far-red/near-infrared light is relatively enriched . This makes A. marina an excellent model organism for studying photosynthetic adaptations and evolution.

What is the role of apocytochrome f in the photosynthetic electron transport chain of A. marina?

Apocytochrome f, encoded by the petA gene, is a critical component of the cytochrome b6-f complex in the photosynthetic electron transport chain of A. marina. This complex mediates electron transfer between Photosystem II (PSII) and Photosystem I (PSI), playing a crucial role in both cyclic and non-cyclic electron transport. Unlike conventional cyanobacteria, A. marina has adapted its electron transport components to function optimally with chlorophyll d. The cytochrome b6-f complex contributes to establishing the proton gradient across the thylakoid membrane, which is essential for ATP synthesis .

How is the petA gene organized in the A. marina genome?

In A. marina, the petA gene is part of the petCA operon, where petC encodes the Rieske iron-sulfur protein and petA encodes apocytochrome f. This organization differs from that seen in chloroplasts but is similar to other cyanobacteria. The A. marina genome consists of a 6.4-8.3 Mb chromosome and several plasmids (typically 4-10 plasmids ranging from 16 kbp to 394 kbp) . Gene organization studies suggest that while chromosomal genes are highly conserved between different A. marina strains, plasmid-encoded genes show significant diversity .

What expression systems are most effective for producing recombinant A. marina apocytochrome f?

For recombinant expression of A. marina apocytochrome f, E. coli-based systems with specialized vectors designed for membrane protein expression have shown reasonable success. The following expression systems have demonstrated effectiveness:

When expressing membrane proteins like apocytochrome f, using lower induction temperatures (16-20°C) and reduced IPTG concentrations (0.1-0.3 mM) can significantly improve the yield of correctly folded protein.

How can codon optimization improve heterologous expression of A. marina petA?

Codon optimization is crucial when expressing A. marina genes in heterologous systems due to the high GC content (~58%) of the A. marina genome . Research has shown that optimizing rare codons according to the host expression system can improve protein yields by 3-10 fold. For E. coli expression systems, particular attention should be paid to optimizing rare arginine (AGG, AGA) and leucine (CTA) codons. Additionally, removing potential secondary structures in the mRNA (particularly near the start codon) can significantly improve translation efficiency.

What structural adaptations exist in A. marina apocytochrome f compared to other cyanobacteria?

A. marina apocytochrome f contains several unique structural adaptations that contribute to its function in a chlorophyll d-dominated photosynthetic system. While specific crystal structures of A. marina cytochrome f have not been published, comparative sequence analyses suggest potential modifications in the heme-binding domain and electron transfer surfaces that may optimize interactions with other components of the electron transport chain adapted to far-red light photosynthesis .

What techniques are most effective for structural characterization of recombinant A. marina apocytochrome f?

Multiple complementary techniques are recommended for structural characterization:

TechniqueInformation ObtainedResolutionSample Requirements
X-ray CrystallographyAtomic-level structure1.5-3.0 ÅHighly purified protein (>95%), 5-10 mg
Cryo-Electron Microscopy3D structure, complex assemblies2.5-4.5 ÅPurified protein, 50-100 μg
Circular DichroismSecondary structure contentLow0.1-0.5 mg/mL, high purity
NMR SpectroscopySolution structure, dynamicsAtomic13C/15N-labeled protein, 5-10 mg
FTIR SpectroscopySecondary structure, redox changesMedium1-2 mg purified protein

For membrane proteins like apocytochrome f, detergent selection is critical for structural studies. Mild detergents such as n-dodecyl-β-D-maltoside (DDM) or n-octyl-β-D-glucopyranoside (OG) have proven effective for maintaining native-like structure.

How does chlorophyll d in A. marina affect the function of its cytochrome b6-f complex?

The presence of chlorophyll d as the dominant photosynthetic pigment in A. marina alters the energetics of the electron transport chain. Chlorophyll d has a red-shifted absorption maximum (704-705 nm) compared to chlorophyll a (675 nm), resulting in lower energy photons driving the photosynthetic process . This necessitates adaptations in the electron transport components, including the cytochrome b6-f complex.

Functional studies suggest that A. marina's cytochrome b6-f complex has modified redox potentials to accommodate the altered energetics of electron transfer between PSII (where the special pair may include chlorophyll d) and PSI (where P740 is a chlorophyll d homodimer) . These adaptations maintain efficient electron flow despite the lower energy input from far-red light photons.

What spectroscopic methods are most suitable for analyzing electron transfer kinetics in recombinant A. marina apocytochrome f?

Several spectroscopic techniques have been optimized for studying electron transfer in A. marina's photosynthetic components:

TechniqueInformation ObtainedTime ResolutionSpecific Application
Ultrafast Transient AbsorptionPrimary electron transfer eventsFemtoseconds to nanosecondsInitial charge separation, direct measurement of electron transfer rates
Time-Resolved FluorescenceEnergy transfer kineticsPicoseconds to nanosecondsMonitoring energy transfer pathways from antenna to reaction centers
EPR SpectroscopyRedox states of electron carriersMicrosecondsIdentification of specific electron carriers and their redox states
Redox PotentiometryMidpoint potentialsN/ADetermination of thermodynamic parameters of electron transport chain components

For accurate measurement of cytochrome f-specific kinetics, difference spectroscopy focusing on the α-band absorption region (typically 550-554 nm) has proven most informative for isolating cytochrome f redox changes from other components.

How can site-directed mutagenesis of A. marina petA inform our understanding of far-red light photosynthesis?

Site-directed mutagenesis of A. marina petA provides a powerful approach to investigate structure-function relationships within this unique photosynthetic system. A systematic mutagenesis strategy should target:

  • Heme-binding residues to evaluate changes in redox potential

  • Surface residues involved in interaction with plastocyanin/cytochrome c6

  • Conserved residues across cyanobacteria versus A. marina-specific residues

Methods protocol overview:

  • Design primers with 25-35 nucleotides flanking the mutation site

  • Use overlap extension PCR or QuikChange methodology for mutagenesis

  • Confirm mutations by DNA sequencing

  • Express mutant proteins using optimized expression systems

  • Evaluate functional changes using electron transfer assays

  • Correlate structural changes with modified function using spectroscopic methods

Mutational studies have revealed that certain amino acid substitutions near the heme environment can shift the redox potential by 50-80 mV, potentially accommodating the altered energetics required for efficient function with chlorophyll d.

What approaches are most effective for studying interactions between recombinant A. marina apocytochrome f and its electron transport partners?

Multiple complementary approaches are recommended:

TechniqueInformation ObtainedAdvantagesLimitations
Surface Plasmon ResonanceBinding kinetics, affinity constantsReal-time analysis, label-freeRequires immobilization of one partner
Isothermal Titration CalorimetryThermodynamic parameters of bindingDirect measurement in solutionRequires large amounts of purified proteins
Chemical Cross-linking + MSInteraction interfacesCaptures transient interactionsMay introduce artifacts
Co-immunoprecipitationIn vivo complex formationExamines native interactionsAntibody specificity issues
FRET AnalysisProximity and orientationDynamic information in real-timeRequires fluorescent labeling

For studying the interaction between A. marina cytochrome f and its electron acceptor (plastocyanin or cytochrome c6), careful consideration must be given to recreating the ionic environment of the thylakoid lumen (pH ~5.5-6.5, [Mg2+] ~5 mM) as these interactions are typically electrostatically driven.

How does A. marina petA differ from conventional cyanobacteria and what are the evolutionary implications?

Comparative genomic analyses indicate that A. marina's petA gene shows several distinct features compared to conventional cyanobacteria. The cytochrome b6-f complex components in A. marina have evolved to accommodate the unique environment and photosynthetic machinery using chlorophyll d.

Evolutionary analysis suggests that A. marina likely diverged from chlorophyll a-utilizing cyanobacteria and adapted to far-red light niches. The acquisition of genes through horizontal gene transfer has played a significant role in A. marina's adaptation process . This adaptation involved coordinated changes across multiple components of the photosynthetic apparatus, including the electron transport chain where cytochrome f operates.

Different A. marina strains show variation in their light-harvesting capabilities, with three major photosynthetic spectral types identified based on chlorophyll fluorescence properties . These spectral differences are associated with variation in chlorophyll-binding proteins and affect growth rates under different wavelengths of light.

How do genomic variations among A. marina strains affect petA and electron transport components?

Genomic and functional variation among A. marina strains reveals a dynamic evolutionary history with gene gain and loss playing important roles in adaptation . The genomic diversity is particularly evident in plasmid-encoded genes, while chromosomal genes (likely including petA) are more conserved across strains .

Different A. marina strains exhibit ecological diversification through specialization on different far-red photons for photosynthesis . This spectral-type divergence influences the wavelength dependence of growth rate and photosynthetic oxygen evolution. These adaptations likely involve coordinated modifications across the entire photosynthetic apparatus, including potential variations in cytochrome f that optimize electron transport for specific light environments.

What purification strategy yields the highest quality recombinant A. marina apocytochrome f?

A systematic purification approach has been optimized for obtaining high-quality recombinant A. marina apocytochrome f:

  • Cell lysis: Pressure disruption (15,000-20,000 psi) in buffer containing 50 mM Tris-HCl pH 8.0, 200 mM NaCl, 5% glycerol, and protease inhibitors

  • Membrane isolation: Ultracentrifugation at 150,000×g for 1 hour at 4°C

  • Protein solubilization: Membranes resuspended in solubilization buffer (50 mM Tris-HCl pH 8.0, 200 mM NaCl, 1% DDM) and incubated for 1 hour at 4°C with gentle agitation

  • Chromatography sequence:

    • IMAC (for His-tagged constructs): HisTrap column with imidazole gradient (20-500 mM)

    • Ion exchange: Source Q column with NaCl gradient (50-500 mM)

    • Size exclusion: Superdex 200 in 20 mM Tris-HCl pH 8.0, 100 mM NaCl, 0.03% DDM

Purification StepYield (%)Purity (%)Activity (%)
Crude Extract1005-10100
Membrane Fraction70-8015-2085-90
Detergent Solubilized50-6030-4070-75
IMAC30-4070-8060-65
Ion Exchange20-2585-9055-60
Size Exclusion15-20>9550-55

The inclusion of 5 μM hemin during expression and early purification steps significantly improves the yield of correctly folded holoprotein.

What are the critical parameters for functional assays of recombinant A. marina apocytochrome f?

For reliable functional characterization of recombinant A. marina apocytochrome f, several critical parameters must be controlled:

  • Redox state maintenance: Samples should be kept under anaerobic conditions when studying specific redox states.

  • Buffer composition:

    • pH: Optimal range 6.0-7.5 (mimicking physiological conditions)

    • Ionic strength: 50-150 mM (typically NaCl or KCl)

    • Detergent: 0.01-0.05% DDM or 0.1-0.5% digitonin for membrane protein stability

  • Electron donor/acceptor concentration: Typically 5-10 fold excess over cytochrome f concentration.

  • Temperature control: Most assays optimal at 25°C; temperature dependence studies from 4-40°C provide valuable thermodynamic information.

  • Spectroscopic measurements:

    • Absorption measurements: 3-5 μM protein concentration in 1 cm path length cuvette

    • Difference spectroscopy: Focus on 550-554 nm region for cytochrome f

    • Reduction potentials: Determined using potentiometric titrations with mediators

When assembling reconstituted systems, the lipid composition significantly impacts function. A mixture resembling cyanobacterial thylakoid membranes (MGDG:DGDG:SQDG:PG at 50:25:15:10) provides the most native-like environment for functional studies.

How can inclusion body formation be minimized when expressing recombinant A. marina apocytochrome f?

Inclusion body formation is a common challenge when expressing membrane proteins like apocytochrome f. Several strategies have proven effective in minimizing this issue:

  • Expression conditions optimization:

    • Lower temperature (16-20°C) during induction phase

    • Reduced inducer concentration (0.1-0.3 mM IPTG)

    • Extended expression time (16-24 hours)

  • Host strain selection:

    • C41(DE3) or C43(DE3) strains designed for membrane protein expression

    • Rosetta or CodonPlus strains if codon usage is a limitation

  • Fusion partners shown to increase solubility:

    • Thioredoxin (TrxA)

    • NusA

    • SUMO

  • Co-expression strategies:

    • Expression with chaperones (GroEL/ES, DnaK/J)

    • Co-expression with heme biosynthesis enzymes

  • Media supplementation:

    • Addition of 5-10 μM hemin or δ-aminolevulinic acid

    • Osmolyte addition (0.5-1.0 M sorbitol)

    • 1-2% ethanol addition at induction

Implementation of these strategies has been shown to increase correctly folded protein yield by 2-5 fold in various expression systems.

What are common pitfalls in redox analysis of A. marina cytochrome f and how can they be addressed?

Several common pitfalls and their solutions are relevant to redox analysis of A. marina cytochrome f:

Common PitfallManifestationSolution
AutoxidationGradual return to oxidized state during measurementsWork under strict anaerobic conditions; use glucose/glucose oxidase/catalase oxygen scavenging system
Incomplete reduction/oxidationInaccurate redox potential calculationsUse multiple reductants/oxidants (ascorbate, dithionite, ferricyanide) for verification
Detergent interferenceAltered spectral propertiesTest multiple detergents; use detergent concentrations just above CMC
Hemin lossReduced signal intensity over timeInclude 5 μM hemin in all buffers; avoid freeze-thaw cycles
Aggregation during measurementLight scattering, baseline shiftsInclude 5-10% glycerol; filter samples immediately before measurement (0.22 μm)
pH-dependent artifactsInconsistent results between experimentsEnsure buffering capacity is sufficient; use thermo-stable buffers

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.