Recombinant Acaryochloris marina ATP synthase subunit b 1 (atpF1)

Shipped with Ice Packs
In Stock

Description

Genomic Context and Functional Role

In A. marina, the atpF1 gene (AM1_0894) is part of a plasmid-encoded ATP synthase operon distinct from the chromosomal F-type ATP synthase. This plasmid-borne ATP synthase lacks the δ subunit (atpH), forming an N-type ATP synthase potentially adapted for sodium transport . Key findings include:

  • Sodium-Transporting Capability: The plasmid-encoded ATP synthase shares conserved ion-binding motifs with the Na⁺-ATPase of Aphanothece halophytica, a halotolerant cyanobacterium .

  • Horizontal Gene Transfer (HGT): The ATP synthase operon likely originated via HGT, enabling A. marina to thrive in saline environments .

  • Strain-Specific Variation: Strains like MBIC11017 retain plasmid-encoded ATP synthases, while others (e.g., MBIC10699) lack them, correlating with phenotypic differences in salt tolerance .

Research Applications and Biotechnological Potential

Recombinant atpF1 is utilized in:

ApplicationDetails
ELISA DevelopmentImmunoassays for antibody detection or protein quantification
Structural StudiesCrystallography to elucidate sodium-binding mechanisms
Salt Tolerance EngineeringHeterologous expression in freshwater cyanobacteria to enhance osmoregulation

Comparative Functional Analysis

The plasmid-encoded ATP synthase in A. marina differs from canonical H⁺-transporting ATP synthases in:

FeaturePlasmid-Encoded ATP SynthaseChromosomal ATP Synthase
Ion SpecificityNa⁺ (putative) H⁺
Subunit CompositionLacks δ subunit (atpH) Contains δ subunit
Genomic LocationPlasmid pREB4 Chromosome

Amino Acid Sequence Highlights

The atpF1 sequence (UniProt ID: B0BZL0) includes:

  • Hydrophobic Stretches: Critical for membrane integration (e.g., VNLVIVIGLLIYFGRGFLGESLVKR) .

  • Conserved Motifs: Align with F0 subunit b in other cyanobacteria, though plasmid-encoded variants show reduced homology to chromosomal counterparts .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All protein shipments default to blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
atpF1; AM1_0894; ATP synthase subunit b 1; ATP synthase F(0 sector subunit b 1; ATPase subunit I 1; F-type ATPase subunit b 1; F-ATPase subunit b 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-186
Protein Length
full length protein
Species
Acaryochloris marina (strain MBIC 11017)
Target Names
atpF1
Target Protein Sequence
MGMFNWLASAGMTGFPQLAEAGGYSLNFDILEANLVNLVIVIGLLIYFGRGFLGESLVKR REAIETAISEAEANQEKAAATLAEEQEKLAQAQAEAKKILANAQTNASKAKEQILAEAKT EIQRIKDAGSQDTSASQERAIAEIRQRVTAMALEKVEADLKNQLGNNESAQRKLVDQSIA LLGGNS
Uniprot No.

Target Background

Function

F1F0 ATP synthase synthesizes ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two domains: F1, containing the extramembrane catalytic core, and F0, containing the membrane proton channel. These are linked by a central and peripheral stalk. ATP synthesis within the F1 catalytic domain is coupled, via a rotary mechanism of the central stalk subunits, to proton translocation. This protein is a component of the F0 channel and forms part of the peripheral stalk, linking F1 to F0.

Database Links
Protein Families
ATPase B chain family
Subcellular Location
Cellular thylakoid membrane; Single-pass membrane protein.

Q&A

What is Acaryochloris marina ATP synthase subunit b 1 (atpF1)?

ATP synthase subunit b 1 (atpF1) is a crucial component of the F-type ATP synthase in Acaryochloris marina. This protein is encoded by the atpF1 gene (AM1_0894) and functions as part of the membrane-embedded F0 sector of the ATP synthase complex. The full-length protein consists of 186 amino acids and plays a structural role in connecting the F1 catalytic domain to the F0 proton channel within the ATP synthase complex . This subunit helps maintain the structural integrity of the ATP synthase, which is essential for the conversion of electrochemical gradient energy into chemical energy in the form of ATP.

How does ATP synthase function in photosynthetic energy production of A. marina?

The ATP synthase complex in A. marina consists of two main components: the membrane-embedded F0 sector (which includes the b subunit encoded by atpF1) and the catalytic F1 sector. The F0 sector forms a proton channel across the thylakoid membrane, while the F1 sector contains the catalytic sites for ATP synthesis. The proton gradient established during photosynthesis drives protons through the F0 sector, causing conformational changes in the F1 sector that lead to ATP synthesis.

Interestingly, many A. marina strains possess a second set of ATP synthase genes that encode a sodium-transporting ATPase (Na⁺-ATPase), which may contribute to salt tolerance in these marine cyanobacteria .

How is recombinant Acaryochloris marina ATP synthase subunit b 1 (atpF1) expressed and purified?

Recombinant A. marina atpF1 protein can be expressed using an E. coli expression system, as indicated in the product information . The typical methodology involves:

  • Cloning: The atpF1 gene sequence is cloned into an appropriate expression vector containing a strong promoter (such as T7) and often includes an affinity tag (His-tag, GST-tag) to facilitate purification.

  • Transformation: The recombinant plasmid is transformed into a competent E. coli expression strain, typically BL21(DE3) or its derivatives.

  • Expression induction: Bacterial cultures are grown to an appropriate density (OD600 of 0.6-0.8) before induction with IPTG (isopropyl β-d-1-thiogalactopyranoside) or other suitable inducers.

  • Cell harvest and lysis: Cells are harvested by centrifugation and lysed using mechanical methods (sonication, French press) or chemical methods (lysozyme treatment followed by detergent solubilization).

  • Purification: The tagged protein is purified using affinity chromatography (Ni-NTA for His-tagged proteins), followed by additional purification steps such as ion exchange chromatography and size exclusion chromatography to achieve high purity.

  • Quality assessment: The purified protein is analyzed by SDS-PAGE, western blotting, and mass spectrometry to confirm identity and purity.

What challenges exist in expressing membrane proteins like atpF1?

Expressing membrane proteins such as atpF1 presents several specific challenges:

  • Protein folding and toxicity: Overexpression of membrane proteins can be toxic to E. coli host cells due to saturation of the membrane protein insertion machinery and disruption of membrane integrity.

  • Solubilization: As atpF1 is a membrane protein with transmembrane domains (evident from its sequence "LVNLVIVIGLLIYFGRGF" ), it requires proper detergents for solubilization and to maintain native conformation during purification.

  • Protein stability: Membrane proteins are often unstable when removed from the lipid bilayer, necessitating optimization of buffer conditions (pH, salt concentration, additives) to enhance stability.

  • Expression yield: Membrane proteins typically express at lower levels than soluble proteins, requiring optimization of growth conditions, induction parameters, and potentially the use of specialized expression hosts.

  • Functional assays: Verifying the functionality of recombinant atpF1 is challenging as it naturally functions as part of the multisubunit ATP synthase complex.

How does the structure of atpF1 in Acaryochloris marina relate to its adaptation to far-red light environments?

The ATP synthase complex, including atpF1, plays a critical role in the bioenergetics of A. marina, which has evolved to utilize far-red light for photosynthesis. While atpF1 itself does not directly interact with light, its structure and function within the ATP synthase complex must be optimized to work efficiently with the photosynthetic machinery that uses chlorophyll d.

Acaryochloris marina's photosystems have unique structural adaptations that allow them to function with far-red light, which provides less energy per photon than the visible light used by most photosynthetic organisms. The PSI reaction center of A. marina contains a special pair (P740) composed of chlorophyll d and its epimer chlorophyll d', and utilizes pheophytin a as the primary electron acceptor . These adaptations affect the entire energy transduction chain, including the proton gradient that drives ATP synthase.

The atpF1 subunit must therefore be structurally adapted to function optimally within this specialized photosynthetic system. The protein sequence of atpF1 may contain specific amino acid substitutions that optimize its interaction with other ATP synthase subunits and its function in the unique bioenergetic context of A. marina's far-red light photosynthesis.

What is the significance of the second set of ATP synthase genes in A. marina?

Many A. marina strains possess a second set of ATP synthase genes that encode a sodium-transporting ATPase (Na⁺-ATPase) . This second set of genes is located on a conserved ~100 kbp block of plasmid sequence in strains such as MBIC11017 (plasmid pREB4), CCMEE 5410, and S15 .

The Na⁺-ATPase genes in A. marina are homologous to and share conserved gene order with the Na⁺-ATPase operon of the halotolerant cyanobacterium Aphanothece halophytica . The Na⁺-ATPase in A. halophytica functions as a sodium pump with increased activity at higher NaCl concentrations, and heterologous expression of these genes conferred enhanced salt tolerance in the freshwater cyanobacterium Synechococcus PCC 7942 .

The presence of this second set of ATP synthase genes suggests that A. marina has evolved additional bioenergetic mechanisms that may contribute to its ability to thrive in various marine environments. This dual ATP synthase system (H⁺-ATPase encoded by chromosomal genes including atpF1, and Na⁺-ATPase encoded by plasmid genes) may provide A. marina with metabolic flexibility and enhanced salt tolerance.

How does horizontal gene transfer contribute to the evolution of ATP synthase in A. marina?

Horizontal gene transfer (HGT) appears to have played a significant role in the evolution of A. marina, including its ATP synthase genes. The genome of A. marina is notably large for a cyanobacterium, consisting of a chromosome (6.4 Mb in strain MBIC10699) and multiple plasmids, with a total genome size of approximately 7.6 Mb .

The sodium-transporting ATPase genes found in many A. marina strains appear to have been acquired through HGT, as they share homology with the Na⁺-ATPase operon of Aphanothece halophytica . This acquisition likely contributed to the adaptation of A. marina to marine environments.

Furthermore, the differential retention of genes across A. marina strains suggests ongoing genome evolution through gene acquisition and loss. For example, comparing the closely related strains MBIC11017 and MBIC10699 reveals that while chromosomal genes are highly conserved, the genes encoded on plasmids are significantly diverse . This genomic plasticity, facilitated by HGT, likely contributes to the adaptive potential of A. marina in various ecological niches.

What experimental techniques are used to study atpF1 structure-function relationships?

Several experimental approaches can be employed to study the structure-function relationships of atpF1:

  • Site-directed mutagenesis: Specific amino acid residues in atpF1 can be mutated to assess their role in protein function, stability, and interactions with other ATP synthase subunits.

  • Protein-protein interaction studies: Techniques such as co-immunoprecipitation, pull-down assays, and crosslinking followed by mass spectrometry can identify interaction partners of atpF1 within the ATP synthase complex.

  • Structural studies: Cryo-electron microscopy has been successfully used to determine the structure of photosystems in A. marina and could potentially be applied to study ATP synthase structure, including the arrangement of atpF1.

  • Functional reconstitution: Purified recombinant atpF1 can be reconstituted with other ATP synthase subunits to assess its role in complex assembly and function.

  • Comparative genomics and bioinformatics: Analysis of atpF1 sequences across different A. marina strains and related species can provide insights into conserved regions important for function and regions that have undergone adaptive evolution.

How can researchers assess the functional integration of atpF1 in ATP synthase complexes?

Assessing the functional integration of atpF1 in ATP synthase complexes requires multiple complementary approaches:

  • ATP synthase activity assays: Measuring ATP synthesis or hydrolysis activity in reconstituted systems containing recombinant atpF1 and other ATP synthase subunits.

  • Proton/sodium translocation assays: Using fluorescent probes or radioisotopes to measure ion translocation across membranes in systems containing atpF1.

  • Membrane potential measurements: Assessing the effect of atpF1 incorporation on membrane potential in reconstituted proteoliposomes.

  • Structural integrity assessment: Using techniques such as native gel electrophoresis, analytical ultracentrifugation, or size exclusion chromatography to evaluate whether atpF1 contributes to proper assembly of the ATP synthase complex.

  • In vivo complementation studies: Expressing recombinant atpF1 in heterologous systems with ATP synthase deficiencies to assess functional complementation.

How can atpF1 research contribute to understanding photosynthetic adaptation to extreme environments?

Research on A. marina atpF1 and the ATP synthase complex can provide valuable insights into photosynthetic adaptation to extreme environments:

  • Far-red light adaptation: Understanding how the ATP synthase complex, including atpF1, is optimized to function with the unique photosynthetic apparatus of A. marina can reveal mechanisms of adaptation to far-red light environments.

  • Salt tolerance mechanisms: The presence of both H⁺-ATPase (including atpF1) and Na⁺-ATPase in A. marina suggests adaptations for salt tolerance. Studying these systems can reveal how ATP synthase variants contribute to osmotic stress responses.

  • Niche adaptation: A. marina grows in dense clusters interspersed with other microbes in niches enriched in near-infrared radiation (NIR) and depleted of visible light . Understanding how atpF1 and ATP synthase function in these conditions can reveal mechanisms of niche adaptation.

  • Bioenergetic efficiency: A. marina must efficiently utilize the lower energy yield from far-red light for photosynthesis. Research on ATP synthase can reveal how bioenergetic efficiency is optimized under energy-limited conditions.

What are the implications of atpF1 research for biotechnological applications?

Research on A. marina atpF1 has several potential biotechnological implications:

  • Designer photosynthetic systems: Knowledge of how ATP synthase components like atpF1 function with chlorophyll d-based photosystems could inform the design of artificial photosynthetic systems capable of utilizing far-red light.

  • Salt-tolerant crop development: Understanding how the dual ATP synthase system in A. marina contributes to salt tolerance could inform strategies for engineering salt-tolerant crops.

  • Bioenergy applications: Insights into the efficient coupling of far-red light photosynthesis with ATP synthesis could inspire novel bioenergy systems capable of utilizing broader spectrum light.

  • Protein engineering: The structure-function relationships elucidated from atpF1 research could guide the engineering of ATP synthase components with enhanced stability or altered ion specificity.

What are common issues when working with recombinant atpF1 and how can they be addressed?

Working with recombinant atpF1 presents several challenges that researchers should be prepared to address:

  • Poor expression levels:

    • Solution: Optimize codon usage for the expression host, use lower induction temperatures (16-25°C), and consider specialized expression strains (C41/C43, Lemo21).

  • Protein aggregation:

    • Solution: Express atpF1 as a fusion with solubility-enhancing tags (MBP, SUMO), optimize buffer conditions, and use mild detergents for membrane protein solubilization.

  • Loss of function during purification:

    • Solution: Include stabilizing agents (glycerol, specific lipids) in purification buffers and minimize exposure to harsh conditions.

  • Difficulties in functional assays:

    • Solution: Develop simplified assays focusing on specific aspects of atpF1 function, such as protein-protein interactions or contribution to complex stability.

  • Verification of native conformation:

    • Solution: Use circular dichroism spectroscopy to verify secondary structure content and thermal stability assays to assess protein folding.

How can researchers validate the specificity of atpF1 interactions within the ATP synthase complex?

Validating the specificity of atpF1 interactions requires multiple complementary approaches:

  • Control experiments: Include negative controls (unrelated membrane proteins) and positive controls (known interaction partners) in all interaction studies.

  • Competition assays: Use unlabeled atpF1 to compete with labeled atpF1 in interaction assays to demonstrate specificity.

  • Mutational analysis: Create site-specific mutations in predicted interaction interfaces and assess their effect on complex formation.

  • Cross-validation: Confirm interactions using multiple independent techniques (e.g., co-immunoprecipitation, FRET, surface plasmon resonance).

  • In vivo validation: Complement interaction studies with functional assays in cellular systems to verify the physiological relevance of observed interactions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.