Recombinant Acaryochloris marina Cytochrome c biogenesis protein CcsB (ccsB)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Acaryochloris marina Cytochrome c Biogenesis Protein CcsB (ccsB)

Recombinant Acaryochloris marina Cytochrome c Biogenesis Protein CcsB (CcsB) is a protein involved in the biogenesis of cytochrome c, an essential heme protein participating in cellular energy production in many organisms . Acaryochloris marina is a unique marine cyanobacterium notable for its use of chlorophyll d, which absorbs far-red light, and its genetic adaptations via horizontal gene transfer .

Function and Significance of CcsB

CcsB functions as a cytochrome c synthase, catalyzing the covalent attachment of heme to apocytochrome c, a process crucial for cytochrome c maturation . Cytochrome c, with its heme cofactor, is vital in electron transfer chains in mitochondria and bacteria . The CcsB protein, along with CcsA, forms a complex (CcsBA) that acts as both a heme exporter and a cytochrome c synthase, featuring two heme-binding sites .

Biochemical Properties and In Vitro Activity

Purified CcsB exhibits in vitro cytochrome c synthase activity, facilitating the attachment of heme to apocytochrome c . Studies show that CcsB can attach heme to peptide substrates, with variations in sequence requirements compared to mitochondrial cytochrome c synthases .

PropertyDescription
Source OrganismAcaryochloris marina
FunctionCytochrome c biogenesis; heme attachment to apocytochrome c
In vitro ActivityCapable of synthesizing cytochrome c and releasing it in its native state
Substrate RecognitionRecognizes and attaches heme to various peptides, with less stringent sequence requirements compared to mitochondrial counterparts
Heme-Binding SitesTwo sites; one internal membrane site and an external WWD/P-His site

Role in Horizontal Gene Transfer and Adaptation

Acaryochloris marina has adapted to different environments through horizontal gene transfer (HGT), acquiring genes that enhance its survival and photosynthetic capabilities . The reacquisition of phycobiliprotein (PBP) genes in certain A. marina strains exemplifies this, allowing them to harvest light wavelengths more efficiently .

Comparative Studies with Mitochondrial Systems

In vitro reconstitution studies have revealed significant differences between bacterial CcsBA and human mitochondrial cytochrome c synthases (HCCS) . CcsBA does not require the alpha helix 1 region of cytochrome c for heme attachment, unlike HCCS, indicating different recognition requirements .

Research Applications and Methods

Recombinant CcsB is utilized in various research applications, including:

  • In vitro reconstitution assays: Studying the mechanism of cytochrome c biogenesis .

  • Spectroscopic analyses: Examining heme attachment and cytochrome c maturation .

  • ELISA assays: Detecting and quantifying CcsB protein levels .

  • Recombinant expression: Producing holocytochrome c in E. coli .

Blue-Light Power Sensor

Acaryochloris marina also contains D XCF cyanobacteriochromes (CBCRs) that function as photoreceptors . One CBCR, AM1_1870g4, acts as a blue-light power sensor, displaying unidirectional photoconversion without the typical Z/E isomerization .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ccsB; ccs1; AM1_1809; Cytochrome c biogenesis protein CcsB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-456
Protein Length
full length protein
Species
Acaryochloris marina (strain MBIC 11017)
Target Names
ccsB
Target Protein Sequence
MTSNLGQPQAFFKKTLVPVLADLRLAIVLLLAIALFSISGTVIEQGQSLEFYQANYPEEP ALFGFLTWKVLVTIGLDHVYATWWFLSLLILFGTSLTACTFMRQLPALKAARSWQFYKKP RQFGKLALSTTLDPDQKPSLLKALEKNRYKVFEEDQSIYARKGITGRIGPIIVHASMILI LLGSIWGSLTGFMAQEMIPSGTTAKVSNIVKSGPWSGAQIPRDWAVQVNRFWIDYTPEGQ IDQFYSDLSIVDEDKNELDRQTIHVNQPLKHKGVTLYQADWSIAGVRVQLNNSPVLQLPM APLEAAGGRIWGTWVPTKPDLSAGVTLLTTDLQGTVVVYDESGKLVSTVRTGMSTDVNDI SLKLVELVGSTGLQIKSDPGIPWIYAGFGLLMIGVIMSYVSHSQIWLLTADDQLYVGGRT NRALLTFERELVEMIESSASDSALSPSTNPQPQEVA
Uniprot No.

Target Background

Function
Essential for the biogenesis of c-type cytochromes (cytochrome c6 and cytochrome f), specifically during heme attachment.
Database Links
Protein Families
Ccs1/CcsB family
Subcellular Location
Cellular thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the Acaryochloris marina Cytochrome c biogenesis protein CcsB and what is its role in bacterial systems?

Cytochrome c biogenesis protein CcsB (also known as ccs1) is a membrane-associated protein that plays a critical role in System II cytochrome c biogenesis pathways. It forms a functional complex with CcsA that is responsible for heme delivery and periplasmic cytochrome c-heme ligation in bacteria . This protein-complex carries out essential functions in the electron transport chain by facilitating the proper attachment of heme groups to c-type cytochromes. In Acaryochloris marina strain MBIC11017, CcsB is encoded by the gene AM1_1809 and consists of 456 amino acids .

How does CcsB from Acaryochloris marina differ from cytochrome c biogenesis proteins in other cyanobacteria?

While the core function of CcsB is conserved across species, the Acaryochloris marina variant exists within an organism that has undergone significant genome expansion and adaptation. A. marina possesses one of the largest bacterial genomes sequenced (8.3 million base pairs), with extensive gene duplication . Unlike many other cyanobacteria, A. marina has uniquely adapted to use chlorophyll d as its primary photosynthetic pigment, allowing it to efficiently utilize far-red light for photosynthesis . This ecological adaptation may have influenced the evolutionary trajectory of its protein systems, including CcsB, although the protein itself maintains its fundamental role in cytochrome c biogenesis.

How does the CcsB-CcsA complex function in the cytochrome c maturation pathway?

In the System II cytochrome c maturation pathway, the CcsB-CcsA protein complex serves as the central machinery for heme delivery and cytochrome c-heme ligation in the periplasmic space. Genetic and biochemical studies have demonstrated that this complex can functionally replace the entire eight-gene system I pathway in Escherichia coli when expressed as a single fused ccsBA polypeptide .

The complex operates by:

  • Receiving reduced heme from the cytoplasm

  • Transporting it across the membrane through a channel formed by the complex

  • Delivering the heme to the periplasmic space

  • Facilitating the stereospecific attachment of the heme group to the CXXCH motif in the apocytochrome c

Unlike System I, which uses a covalently bound heme chaperone (holo-CcmE) as an intermediate, the CcsB-CcsA system doesn't form a covalent intermediate with heme during the delivery process . This difference affects how each system responds to heme availability in the cell, with System I being able to use endogenous heme at much lower levels and maintain a heme reservoir via holo-CcmE.

What are the optimal conditions for recombinant expression of Acaryochloris marina CcsB?

For recombinant expression of A. marina CcsB:

  • Expression System: E. coli is the recommended heterologous expression system for this membrane protein .

  • Construct Design:

    • Full-length protein (amino acids 1-456)

    • N-terminal His-tag for purification purposes

    • Codon optimization for E. coli may improve expression yields

  • Expression Parameters:

    • Lower temperatures (16-25°C) often yield better results for membrane proteins

    • IPTG concentration: 0.1-0.5 mM typically provides good induction

    • Growth in rich media such as TB or 2xYT can increase biomass and protein yield

  • Considerations:

    • As a membrane protein, expression levels may be limited compared to soluble proteins

    • Toxicity may be observed due to membrane protein overexpression

    • Auto-induction media can be considered as an alternative to IPTG induction

What purification strategy works best for obtaining high-purity recombinant CcsB protein?

A multi-step purification strategy is recommended for isolating recombinant CcsB:

  • Membrane Fraction Isolation:

    • Cell lysis (sonication or high-pressure homogenization)

    • Differential centrifugation to isolate membrane fractions

    • Solubilization using appropriate detergent (e.g., DDM, LDAO, or Triton X-100)

  • Affinity Chromatography:

    • Immobilized metal affinity chromatography (IMAC) using Ni-NTA for His-tagged protein

    • Wash buffers containing low imidazole concentrations (10-40 mM)

    • Elution with higher imidazole concentration (250-500 mM)

  • Secondary Purification:

    • Size exclusion chromatography to remove aggregates and obtain homogeneous protein

    • Ion exchange chromatography may be used for further purification

  • Final Product:

    • Buffer exchange to storage buffer (Tris/PBS-based, pH 8.0, with 6% Trehalose)

    • Concentration determination by spectrophotometric methods

    • Storage as lyophilized powder or in solution with 50% glycerol at -20°C/-80°C

How can researchers verify the functional activity of purified recombinant CcsB?

Functional verification of recombinant CcsB requires assessment of its ability to participate in cytochrome c maturation:

  • Reconstitution Assays:

    • Reconstitution with recombinant CcsA in proteoliposomes

    • Measurement of heme transport activity across the membrane

    • Assessment of heme binding capacity using spectroscopic methods

  • Complementation Studies:

    • Expression in E. coli strains deficient in cytochrome c maturation (Δccm)

    • Restoration of cytochrome c maturation can be measured by:

      • Detection of mature cytochrome c using peroxidase activity assays

      • Spectroscopic analysis of heme incorporation into cytochromes

      • Functional assays of electron transport chain activity

  • Binding Studies:

    • Analysis of heme binding using UV-visible spectroscopy

    • Protein-protein interaction studies with CcsA using pull-down assays or surface plasmon resonance

What methods should be used to assess endotoxin contamination in recombinant CcsB preparations?

Endotoxin contamination is a critical concern for recombinant proteins expressed in E. coli, as even low levels can severely impact downstream applications, particularly in cell-based assays:

  • Limulus Amebocyte Lysate (LAL) Test:

    • The standard method for quantifying endotoxin contamination

    • Detection limits as low as 0.01 EU/mL can be achieved

    • Various formats are available: gel-clot, chromogenic, and turbidimetric assays

  • Fluorescence-Based Endotoxin Assays:

    • Alternative to LAL with potentially higher sensitivity

    • May be less susceptible to interference from protein samples

  • Cell-Based Reporter Assays:

    • Engineered HEK293 cells expressing TLR4, MD-2, and CD14 along with NF-κB luciferase reporter

    • Highly sensitive to LPS and can detect biologically relevant contamination

    • Particularly useful when working with LPS-sensitive cells like CD1c+ dendritic cells

  • Endotoxin Removal:

    • If contamination is detected, methods such as Triton X-114 phase separation, ion exchange chromatography, or specialized endotoxin removal resins can be employed

    • Validation of endotoxin removal should be performed after treatment

As demonstrated by research, even endotoxin contamination levels as low as 0.002-2 ng/ml can activate sensitive cell types like CD1c+ dendritic cells, potentially confounding experimental results .

How can recombinant CcsB be utilized to study the evolution of cytochrome c biogenesis systems in cyanobacteria?

Recombinant CcsB provides a valuable tool for evolutionary studies of cytochrome c biogenesis systems:

  • Comparative Biochemistry:

    • Functional comparison of CcsB from diverse cyanobacterial species

    • Correlation of CcsB structure/function with ecological niches

    • Examination of how A. marina's unique adaptations (chlorophyll d utilization, genome expansion) influenced CcsB evolution

  • Chimeric Protein Analysis:

    • Creation of chimeric CcsB proteins with domains from different species

    • Identification of critical regions for species-specific functionality

    • Analysis of adaptation mechanisms through domain swapping experiments

  • System Reconstitution:

    • Reconstitution of complete cytochrome c biogenesis systems from different species

    • Investigation of compatibility between components from diverse sources

    • Assessment of efficiency under varying environmental conditions (light quality, oxygen levels)

  • Evolutionary Rate Analysis:

    • Comparison of evolutionary rates between CcsB and other components of photosynthetic machinery

    • Correlation with the unique genome expansion observed in A. marina (8.3 million base pairs)

    • Investigation of the relationship between gene duplication events and functional adaptation

What insights can be gained by studying CcsB in the context of A. marina's unique photosynthetic adaptations?

A. marina's remarkable adaptation to use chlorophyll d for photosynthesis provides a unique context for studying CcsB:

  • Relationship to Photosystems:

    • Investigation of how cytochrome c biogenesis relates to altered photosystems using chlorophyll d

    • Examination of potential adaptations in cytochrome c that might optimize function with modified photosynthetic machinery

    • Analysis of electron transport chain modifications in far-red light conditions

  • Niche Adaptation Mechanisms:

    • Study of CcsB function under far-red light conditions that characterize A. marina's ecological niche

    • Analysis of how cytochrome c biogenesis supports A. marina's ability to thrive in environments dominated by other phototrophs

    • Investigation of potential co-evolution between CcsB and photosystem components

  • Genomic Context Analysis:

    • Exploration of the genomic context of ccsB in A. marina's expanded genome (8.3 million base pairs)

    • Analysis of plasmid vs. chromosomal distribution of cytochrome biogenesis genes

    • Correlation with the extensive gene duplication observed in A. marina, particularly for DNA repair and recombination genes like recA

What are common challenges in working with recombinant CcsB and how can they be addressed?

Researchers working with recombinant CcsB may encounter several challenges:

  • Low Expression Yields:

    • Challenge: As a membrane protein, CcsB may express poorly in heterologous systems

    • Solutions:

      • Use specialized E. coli strains designed for membrane protein expression (C41, C43)

      • Test different fusion tags (His, MBP, SUMO) for improved solubility

      • Optimize growth conditions (temperature, induction timing, media composition)

      • Consider cell-free expression systems for difficult constructs

  • Protein Stability Issues:

    • Challenge: Membrane proteins often show limited stability once extracted from membranes

    • Solutions:

      • Screen multiple detergents for optimal extraction and stability

      • Add stabilizing agents (glycerol, specific lipids, trehalose)

      • Consider nanodiscs or amphipols for maintaining native-like environment

      • Store as lyophilized powder for long-term stability

  • Functional Assessment Difficulties:

    • Challenge: Verifying proper folding and function of isolated CcsB

    • Solutions:

      • Always co-express or reconstitute with CcsA for functional studies

      • Use spectroscopic methods to verify heme interaction capabilities

      • Implement complementation assays in appropriate deletion strains

How can researchers design experiments to distinguish between the roles of CcsB and its interaction partners in cytochrome c biogenesis?

Designing experiments to delineate the specific roles of CcsB versus its interaction partners requires sophisticated approaches:

  • Site-Directed Mutagenesis Strategy:

    • Target conserved residues in different functional domains of CcsB

    • Design mutations that specifically affect:

      • Membrane integration

      • Interaction with CcsA

      • Heme binding capabilities

      • Interaction with apocytochrome c

    • Assess functional consequences of each mutation type

  • Protein-Protein Interaction Mapping:

    • Identify interaction interfaces between CcsB and CcsA using:

      • Crosslinking coupled with mass spectrometry

      • Hydrogen-deuterium exchange mass spectrometry

      • FRET-based interaction assays

    • Map domains involved in complex formation and substrate recognition

  • Stepwise Reconstitution Approach:

    • Isolate and purify individual components (CcsB, CcsA, apocytochrome c)

    • Reconstitute in defined lipid environments (liposomes, nanodiscs)

    • Monitor each step of the cytochrome c maturation process:

      • Heme transport

      • Apocytochrome binding

      • Heme attachment

    • Determine rate-limiting steps and component-specific contributions

  • Comparative Systems Analysis:

    • Leverage the fact that a fused CcsBA protein can replace the eight-gene system I pathway in E. coli

    • Compare the heme delivery mechanisms between Systems I and II:

      • System I: Uses covalently bound heme chaperone (holo-CcmE)

      • System II: No covalent intermediate has been identified

    • Analyze differential responses to varying heme availability

This structured approach enables precise delineation of CcsB's specific contributions within the complex process of cytochrome c biogenesis, advancing our fundamental understanding of these essential bacterial systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.