Recombinant Acaryochloris marina Lipoprotein signal peptidase (lspA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize development accordingly.
Synonyms
lspA; AM1_3652; Lipoprotein signal peptidase; Prolipoprotein signal peptidase; Signal peptidase II; SPase II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-165
Protein Length
full length protein
Species
Acaryochloris marina (strain MBIC 11017)
Target Names
lspA
Target Protein Sequence
MRWKKLLFWGSALLSVGADQLTKFWVTQNFELRRPPAQPDTWPLIQNVFHFTYVTNDGAA FSLFKDSPLLPWLSFLVCLGLIGLGLFGPRFPQWEQAGYGFLLGGAAGNGIDRIFLGEVI DFLDFRLIQFPVFNIADISINVGLACLIFATWQSSRKGSRKTPTP
Uniprot No.

Target Background

Function

This protein specifically catalyzes the removal of signal peptides from prolipoproteins.

Database Links
Protein Families
Peptidase A8 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Acaryochloris marina and why is its LspA of particular interest for research?

Acaryochloris marina is a unique marine cyanobacterium distinguished by its ability to use chlorophyll d as its primary photosynthetic pigment, enabling efficient utilization of far-red light for photosynthesis in environments depleted of visible light . First isolated from didemnid ascidians, A. marina has since been found in diverse marine environments, including as epiphytes on red macroalgae .

A. marina is particularly notable for:

  • Possessing one of the largest bacterial genomes sequenced (~8.3 million base pairs)

  • Having a genome distributed across a main chromosome and nine single-copy plasmids

  • Exhibiting significant genetic mobility and genome expansion due to heavy duplication of genes related to DNA repair and recombination

  • Using chlorophyll d to capture far-red light that other photosynthetic organisms cannot utilize

Its LspA is of interest because lipoprotein signal peptidases play critical roles in bacterial physiology, pathogenicity, and antibiotic resistance. While most LspA research has focused on pathogenic bacteria like Staphylococcus aureus and Pseudomonas aeruginosa , studying LspA from A. marina provides a unique opportunity to understand how this essential enzyme functions in a non-pathogenic organism with unique ecological adaptations and an exceptionally large genome.

How should researchers design expression systems for recombinant A. marina LspA?

When designing expression systems for A. marina LspA, researchers should consider several factors based on successful approaches with other bacterial LspAs:

Recommended Expression System Components:

  • Host strain: E. coli C41 cells have proven effective for expression of membrane proteins from cyanobacteria

  • Vector: pET28a plasmid backbone provides reliable expression

  • Induction conditions: IPTG at 0.1 mM final concentration when OD600 reaches 0.4-0.8

  • Growth temperature: 18°C overnight after induction (rather than continued growth at 37°C)

Purification Strategy:

  • Centrifugation collection of cell pellets post-expression

  • Cell lysis and membrane fraction isolation

  • Solubilization with a mild detergent (LMNG has been successful with other LspAs)

  • Ni-affinity chromatography using a His-tag

  • Size-exclusion chromatography for further purification

As A. marina has a GC-rich genome, codon optimization for E. coli expression may be necessary. Additionally, incorporate a TEV cleavage site between the His-tag and the protein to enable tag removal for structural studies.

What are the most reliable methods to confirm activity of recombinant A. marina LspA?

Activity confirmation for recombinant A. marina LspA should employ multiple complementary approaches:

Gel-shift Assay:
This coupled assay measures LspA's ability to cleave a lipoprotein substrate. Based on methods developed for other bacterial LspAs:

  • Generate a lipidated substrate using Lgt enzyme and pre-prolipoprotein (12 μM)

  • Add purified recombinant LspA (0.5 μM) to the reaction mixture

  • Monitor cleavage by SDS-PAGE, where processed lipoprotein migrates faster than unprocessed form

FRET-based Activity Assay:
A fluorescence resonance energy transfer assay provides real-time monitoring of activity:

  • Design a synthetic peptide substrate with fluorophore/quencher pair that releases fluorescent signal upon cleavage

  • Measure fluorescence in plate reader format

  • Calculate initial reaction velocities at different substrate concentrations

  • Determine kinetic parameters (Km and kcat)

Inhibition Studies:
Confirm enzyme identity via inhibition with known LspA inhibitors:

  • Test globomycin inhibition using concentration range of 0-3.2 mM

  • Generate dose-response curve to determine IC50 values

ParameterWild-type LspAD124A MutantD143A Mutant
kcat (s^-1)0.42 ± 0.03<0.005<0.005
Km (μM)8.6 ± 1.2N/DN/D
IC50 Globomycin (μM)0.35 ± 0.05N/DN/D

Table 1: Expected kinetic parameters for wild-type and catalytic aspartate mutants of LspA, based on studies of related bacterial LspAs. N/D = Not determined due to lack of detectable activity.

How does the genomic context of lspA in A. marina compare with other cyanobacteria?

The genomic context of lspA in A. marina reveals important insights about its evolutionary history and functional relationships:

Location and Organization:

  • Unlike most Acaryochloris genes which show extensive plasmid localization (>25% of putative ORFs are plasmid-encoded) , lspA is typically located on the main chromosome

  • The gene is often found in proximity to other genes involved in lipoprotein processing and cell envelope biogenesis

Comparative Genomic Analysis:
A. marina possesses a complex genomic architecture with significant strain-to-strain variation:

  • Chromosomal genes are highly conserved between closely related strains (e.g., between MBIC11017 and MBIC10699)

  • Plasmid-encoded genes show much greater diversity

  • Comparative analysis of various A. marina strains reveals that while some accessory proteins may vary, core cell envelope maintenance genes like lspA are typically conserved

Evolutionary Implications:

  • The presence of multiple recA copies (7 in total, with 4 on plasmids) in A. marina may contribute to genomic plasticity and potentially affect the evolution of lspA

  • Horizontal gene transfer likely plays a significant role in A. marina's genome expansion, which may include acquisition of novel cell envelope processing machinery

How might A. marina's unique photosynthetic machinery interact with lipoprotein processing pathways?

A. marina's distinctive photosynthetic apparatus may create unique demands on lipoprotein processing pathways that distinguish it from other cyanobacteria:

Membrane Architecture Considerations:
A. marina possesses a complex thylakoid membrane system featuring:

  • Concentric arrangement of thylakoid membranes

  • Regions of appressed and non-appressed membranes

  • Specialized crystalline phycobiliprotein arrays in stromal gaps

This specialized membrane organization likely requires coordinated lipoprotein processing by LspA to maintain proper membrane topology and function.

Photosystem-Specific Lipoproteins:
A. marina's photosystems contain unique features that may depend on LspA activity:

  • PSI in A. marina contains a distinctive electron transfer chain with pheophytin a as the primary electron acceptor (A₀) rather than chlorophyll a found in other photosystems

  • The far-red light adaptation includes a novel subunit Psa27 in the PSI structure

  • The supramolecular organization of phycobiliproteins in membrane-bound patches may require specific lipoproteins for anchoring or organization

Regulatory Network:
Evidence suggests potential cross-talk between photosynthetic and envelope stress responses:

  • Under far-red light conditions, changes in photosystem composition may trigger corresponding changes in lipoprotein processing requirements

  • The extensive genomic capacity of A. marina (8.3 Mbp) supports specialized regulatory mechanisms that may link photosynthesis and lipoprotein processing

What structural features distinguish A. marina LspA from homologs in other bacteria?

Based on structural analyses of LspA from other bacterial species, several distinctive features may characterize A. marina LspA:

Predicted Structural Elements:

  • Core structure likely consists of 4 transmembrane helices with conserved catalytic aspartate residues

  • Active site expected to face the periplasmic/outer side of the cytoplasmic membrane

  • Conserved aspartyl protease catalytic dyad, with aspartate residues positioned to enable nucleophilic attack on substrate peptide bonds

Unique Adaptations:
A. marina's unusual ecological niche may have driven distinctive adaptations in its LspA:

  • Potentially expanded substrate binding pocket to accommodate diverse lipoprotein signal sequences

  • Possible structural modifications to operate optimally in A. marina's membrane environment, which features high chlorophyll d content

  • Potential unique surface residues that mediate interaction with A. marina-specific lgt and lnt enzymes in the lipoprotein processing pathway

Inhibitor Binding Sites:
Crystal structures of LspA from other bacteria (P. aeruginosa and S. aureus) in complex with inhibitors reveal:

  • Globomycin binding resembles a non-cleavable tetrahedral intermediate analog

  • Myxovirescin, despite having a different structure from globomycin, inhibits identical active site regions

  • These inhibitors share a 19-atom motif that mimics part of the substrate lipoprotein

A. marina LspA would likely share these conserved inhibitor binding properties, potentially with adaptations reflecting its evolutionary distance from pathogenic bacteria.

How can researchers optimize heterologous expression of A. marina LspA for structural studies?

Heterologous expression of A. marina LspA for structural studies presents specific challenges that require optimization strategies:

Expression System Enhancements:
Building on protocols developed for other membrane proteins from A. marina:

  • Use specialized E. coli strains (C41/C43) designed for toxic membrane protein expression

  • Consider dual-plasmid systems where chaperones (GroEL/GroES) are co-expressed

  • Implement controlled expression using tunable promoters or auto-induction media

  • Add specific lipids (DOPG at ~250 μM) to expression media to promote proper folding

Fusion Strategies for Improved Stability:

  • N-terminal fusions with MBP (maltose-binding protein) can enhance solubility

  • C-terminal fusions with GFP enable rapid assessment of proper folding

  • Thermostabilizing mutations identified through alanine scanning can improve protein stability

Purification Optimization:

  • Extraction using mild detergents like LMNG (lauryl maltose neopentyl glycol) or DDM (n-dodecyl β-D-maltoside)

  • Lipid nanodiscs or amphipols can provide a more native-like membrane environment

  • SEC-MALS (Size Exclusion Chromatography with Multi-Angle Light Scattering) to confirm monodispersity

Crystallization Approaches:
For crystallographic studies:

  • Lipidic cubic phase (LCP) crystallization has proven successful for other LspA proteins

  • Surface entropy reduction through targeted mutations

  • Antibody fragment (Fab) co-crystallization to provide additional crystal contacts

For cryo-EM studies:

  • Sample vitrification optimization for membrane proteins

  • Use of Volta phase plates to enhance contrast

  • Consider tilted data collection to address preferred orientation issues

What are the methodological challenges in comparing LspA activity across different A. marina strains?

Investigating LspA activity across A. marina strains presents several methodological challenges:

Strain Variability Factors:
A. marina exhibits substantial strain-to-strain variation:

  • Different strains have varying Chl d:Chl a ratios and absorption characteristics

  • Some strains (like MBIC11017) produce phycocyanin while others do not

  • Strains from different geographic locations show genomic adaptations to their specific environments

StrainGeographic OriginPhycocyanin ProductionChl d:Chl a Ratio*Genome Size
MBIC11017Palau (type strain)YesHigh8.3 Mbp
MBIC10699PalauNoHigh7.6 Mbp
S15VariousNoMediumVariable
HP10VariousNoHighVariable
MU03VariousNoMediumVariable

*Table 2: Variation among A. marina strains. Estimated ratios when normalized to pheophytin a .

Standardized Activity Assessment:
To accurately compare LspA activity across strains:

  • Implement identical growth conditions prior to LspA isolation

  • Develop strain-neutral synthetic substrates that eliminate variability in native lipoproteins

  • Control for membrane composition effects by reconstituting purified enzymes in defined lipid environments

  • Utilize coupled enzyme assays where the same Lgt enzyme prepares substrates for all LspA variants

Technical Approaches:

  • Employ chimeric constructs to isolate regions responsible for activity differences

  • Use site-directed mutagenesis to investigate the impact of strain-specific sequence variations

  • Apply hydrogen-deuterium exchange mass spectrometry to compare structural dynamics

  • Develop high-throughput fluorescence-based assays for rapid comparative screening

How might the presence of photoactive pigments affect experimental protocols when working with A. marina LspA?

The presence of photoactive pigments in A. marina creates unique experimental considerations when isolating and characterizing LspA:

Light-Sensitive Protocols:

  • Implement low-light or green-light conditions during cell harvesting and protein purification to prevent photodamage

  • Consider the use of specialized far-red light (>700 nm) for growth that mimics A. marina's natural light environment

  • Test the stability of purified LspA under different light conditions to determine if photoactive contaminants affect enzyme activity

Pigment Contamination Management:

  • Develop additional chromatography steps to remove chlorophyll d and phycobiliprotein contaminants

  • Monitor preparations spectrophotometrically at key wavelengths (750 nm for chlorophyll d; 620 nm for phycocyanin)

  • Implement specific detergent washing steps to remove pigment-protein complexes while retaining LspA activity

Activity Assay Modifications:

  • Screen for absorption/emission wavelength interference between photosynthetic pigments and fluorescent assay components

  • Include controls to account for potential photochemical side reactions

  • Consider the use of radiolabeled substrates for activity assays when optical methods are compromised by pigment interference

Structural Studies Considerations:

  • For crystallography: verify that crystal color is not due to pigment contamination

  • For cryo-EM: assess whether pigment incorporation affects protein contrast or introduces heterogeneity

  • For spectroscopic methods (CD, fluorescence): implement baseline corrections for pigment contributions

What is the potential for using A. marina LspA as a model for developing novel antibiotics?

The structural and functional characteristics of A. marina LspA offer unique insights for antibiotic development:

Comparative Structural Analysis:
Examining LspA from non-pathogenic A. marina alongside pathogenic bacterial LspAs could reveal:

  • Conserved active site architecture essential for function

  • Divergent regions that could enable species-specific targeting

  • Novel binding pockets absent in previously characterized LspAs

Inhibitor Development Strategy:
The finding that structurally different antibiotics (globomycin and myxovirescin) share a 19-atom motif that mimics the substrate lipoprotein provides a blueprint for rational drug design:

  • Use the conserved 19-atom motif as a scaffold for new inhibitor development

  • Incorporate structural elements that interact with species-specific regions

  • Design molecules with improved pharmacokinetic properties

Resistance Mechanisms Investigation:
A. marina's extensive genome and genetic plasticity make it valuable for studying potential resistance mechanisms:

  • Seven copies of recA and related DNA repair genes may provide insight into mutation-based resistance development

  • Examining natural sequence variations across A. marina strains may predict possible resistance mutations

Target Validation Approaches:

  • Generate LspA knockout in model organisms and test complementation with A. marina LspA

  • Develop fluorescent probes based on known inhibitors to monitor binding in vivo

  • Screen compound libraries against both pathogenic and A. marina LspAs to identify differential inhibition profiles

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.