Recombinant Acaryochloris marina NAD (P)H-quinone oxidoreductase subunit 3

Shipped with Ice Packs
In Stock

Description

Overview

Recombinant Acaryochloris marina NAD(P)H-quinone oxidoreductase subunit 3 is a protein component of the NAD(P)H-quinone oxidoreductase complex found in the marine cyanobacterium Acaryochloris marina . This enzyme complex is crucial for electron transport and energy production within the organism . The subunit 3 protein, encoded by the ndhC gene, is a subunit of the NAD(P)H dehydrogenase complex, specifically NDH-1 .

Characteristics and Properties

Acaryochloris marina NAD(P)H-quinone oxidoreductase subunit 3 exhibits the following characteristics:

  • Origin: Derived from the marine cyanobacterium Acaryochloris marina .

  • Function: Part of the NAD(P)H-quinone oxidoreductase complex involved in electron transport .

  • Nomenclature: Also known as NAD(P)H dehydrogenase subunit 3, NADH-plastoquinone oxidoreductase subunit 3, or NDH-1 subunit 3 (short name NDH-C) .

  • Molecular Weight: The full-length protein consists of 120 amino acids .

  • Tag Information: Often expressed with an N-terminal His tag for purification purposes .

  • Purity: Greater than 85% when analyzed by SDS-PAGE .

  • Storage: Recommended storage at -20°C to -80°C, with repeated freezing and thawing cycles avoided . Aliquots can be stored at 4°C for up to one week .

  • Reconstitution: If lyophilized, it should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with the addition of 5-50% glycerol for long-term storage .

Gene and Protein Information

The ndhC gene encodes the NAD(P)H-quinone oxidoreductase subunit 3 . The protein's properties are summarized below.

Table 1: Protein Information

FeatureDescription
Gene NamendhC
Ordered Locus NamesAM1_0132
Protein NamesNAD(P)H-quinone oxidoreductase subunit 3
Alternative NamesNAD(P)H dehydrogenase subunit 3, NADH-plastoquinone oxidoreductase subunit 3, NDH-1 subunit 3 (NDH-C)
EC Number1.6.5.-
Amino Acid SequenceMFALSGYEYLLGFLLLCSLVPALALSASKVLRPSNQGAVRRTTYESGMEPVGGAWIQFNI RYYMFALVFVIFDVETVFLYPWAVAFHKLGVLAFIEALIFIAILIVGLVYAWRKGALEWS
UniProt IDB0C6C4

Biological Role and Significance

Acaryochloris marina is unique because it primarily uses chlorophyll d instead of chlorophyll a for photosynthesis . The NAD(P)H-quinone oxidoreductase complex, which includes subunit 3, plays a vital role in the photosynthetic electron transport chain by transferring electrons from NAD(P)H to quinones . This process is essential for generating the proton gradient that drives ATP synthesis. The ndhC gene is conserved in Acaryochloris species, suggesting its importance for the function of the NDH complex .

Applications

Recombinant Acaryochloris marina NAD(P)H-quinone oxidoreductase subunit 3 is useful in various research applications:

  1. ELISA assays: It can be used as an antigen in enzyme-linked immunosorbent assays (ELISA) for detecting and quantifying antibodies against Acaryochloris marina .

  2. Structural studies: The recombinant protein can be used for structural studies to understand the arrangement of subunits within the NAD(P)H-quinone oxidoreductase complex .

  3. Functional studies: It can be employed in in vitro assays to investigate the electron transfer activity of the NDH complex and the role of subunit 3 in this process .

  4. Protein-protein interaction studies: The protein can be used to identify and characterize proteins that interact with subunit 3 within the NDH complex .

Related Research

Research on Acaryochloris marina and its photosynthetic machinery has revealed several interesting aspects:

  • Acaryochloris species possess unique antenna complexes (Pcb) that bind chlorophyll a/d, encoded by isiA, which shows homology to psbC .

  • Comparative genomic analyses have shown the conservation of alternative ATP synthase and hox-hydrogenase genes in several Acaryochloris strains, suggesting functional relationships and evolutionary history .

  • Studies of chlorophyll biosynthesis genes in photosynthetic organisms, including cyanobacteria, indicate the evolution and adaptation of photosynthetic complexes .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: While the tag type is determined during production, please specify your required tag type for preferential development.
Synonyms
ndhC; AM1_0132; NAD(PH-quinone oxidoreductase subunit 3; NAD(PH dehydrogenase subunit 3; NADH-plastoquinone oxidoreductase subunit 3; NDH-1 subunit 3; NDH-C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-120
Protein Length
full length protein
Species
Acaryochloris marina (strain MBIC 11017)
Target Names
ndhC
Target Protein Sequence
MFALSGYEYLLGFLLLCSLVPALALSASKVLRPSNQGAVRRTTYESGMEPVGGAWIQFNI RYYMFALVFVIFDVETVFLYPWAVAFHKLGVLAFIEALIFIAILIVGLVYAWRKGALEWS
Uniprot No.

Target Background

Function
NDH-1 (NAD(P)H-quinone oxidoreductase) functions as an electron shuttle, transferring electrons from an unidentified donor, via FMN and iron-sulfur (Fe-S) centers, to quinones within the respiratory or photosynthetic chain. In this species, plastoquinone is believed to be the immediate electron acceptor. This process couples the redox reaction to proton translocation, thereby conserving redox energy as a proton gradient. In cyanobacteria, NDH-1 also participates in inorganic carbon concentration.
Database Links
Protein Families
Complex I subunit 3 family
Subcellular Location
Cellular thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Acaryochloris marina and why is it significant for photosynthesis research?

Acaryochloris marina is a unique cyanobacterial species that has evolved the remarkable capability to perform oxygenic photosynthesis using far-red light. Unlike most photosynthetic organisms that primarily utilize chlorophyll a, A. marina predominantly employs chlorophyll d as its main photosynthetic pigment. This adaptation allows it to harvest far-red light with wavelengths around 700-750 nm in vivo, approximately 30 nm longer than the absorption peaks for chlorophyll a-based systems . This shift represents approximately 10% lower photon energy utilization while still maintaining efficient oxygenic photosynthesis.

The significance of A. marina in photosynthesis research cannot be overstated. It represents an evolutionary innovation that expands our understanding of the energetic boundaries of oxygenic photosynthesis. The discovery of this organism demonstrated that the quantum energy requirements previously considered essential for water oxidation in photosynthesis were not absolute thresholds. A. marina's unique photosystems have provided researchers with natural comparative models to investigate the minimal energetic requirements for oxygenic photosynthesis and have opened new avenues for engineering artificial photosynthetic systems that can utilize broader spectral ranges .

What is the NAD(P)H-quinone oxidoreductase subunit 3 (ndhC) and what is its role in A. marina?

NAD(P)H-quinone oxidoreductase subunit 3, encoded by the ndhC gene (AM1_0132), is a critical component of the NDH-1 complex in Acaryochloris marina. This 120-amino acid membrane protein functions within the electron transport chain, facilitating electron transfer from NAD(P)H to quinone molecules . The protein contains multiple transmembrane helices, as indicated by its highly hydrophobic amino acid sequence with numerous leucine and phenylalanine residues that create its characteristic membrane-spanning domains.

In A. marina, ndhC plays an essential role in cyclic electron flow around Photosystem I (PSI), which is particularly important for balancing the ATP/NADPH ratio required for carbon fixation. Unlike linear electron transport that produces both ATP and NADPH, cyclic electron flow generates additional ATP without producing NADPH, allowing the organism to fine-tune its energy metabolism. The NDH-1 complex containing ndhC also contributes to respiration, enabling energy production in darkness, and may participate in CO₂ concentration mechanisms that enhance photosynthetic efficiency in aquatic environments. The unique adaptations of this protein in A. marina likely contribute to the organism's capability to perform efficient photosynthesis using lower-energy far-red light .

How does the structure of A. marina's photosynthetic apparatus differ from conventional cyanobacteria?

Acaryochloris marina possesses a photosynthetic apparatus with several distinctive structural and compositional features that differentiate it from conventional cyanobacteria. The most notable difference is its reliance on chlorophyll d as the predominant photosynthetic pigment rather than chlorophyll a. Structurally, the Photosystem I (PSI) reaction center in A. marina contains 11 subunits arranged in a manner that accommodates the different spectral properties of chlorophyll d .

The special pair of chlorophylls in the PSI reaction center, designated as P740 (named after its peak absorption wavelength), consists of a dimer of chlorophyll d and its epimer chlorophyll d′, differing from the chlorophyll a dimer (P700) found in typical cyanobacteria . Additionally, the primary electron acceptor in A. marina's PSI is pheophytin a, a metal-less chlorin, which contrasts with other type I reaction centers. The pigment ratio analysis reveals approximately 67-70 chlorophyll d molecules per chlorophyll d′ in the PSI complex, with a semi-stoichiometric amount of pheophytin a at approximately 1.92 per reaction center . The electron carriers in A. marina's PSI are arranged in two branches (A-branch and B-branch) related by a pseudo-C2 axis, similar to other type I reaction centers, but with unique adaptations to accommodate the different energetics of chlorophyll d-based photochemistry .

What are the key spectroscopic properties of A. marina's photosystem components?

The spectroscopic properties of Acaryochloris marina's photosystem components reveal critical insights into its unique photochemistry. The primary donor P740 in PSI, when excited by a 532-nm green laser flash, exhibits absorption changes with negative peaks at 740, 710, 690, 650, and 455 nm . This pattern significantly differs from the P700 of conventional photosystems, which typically shows negative peaks at 700 and 430 nm .

Chlorophyll d, the predominant pigment in A. marina, displays a peak absorption wavelength (Qy band) at approximately 697 nm in methanol and 700-750 nm in vivo, which is about 30 nm longer than the 665.2 nm absorption peak of chlorophyll a (670-700 nm in vivo) . This spectral shift allows A. marina to utilize far-red light effectively, despite the approximately 80 mV (10%) lower photon energy compared to chlorophyll a-based systems.

What techniques are optimal for expressing and purifying recombinant A. marina ndhC?

The expression and purification of recombinant Acaryochloris marina NAD(P)H-quinone oxidoreductase subunit 3 requires specialized techniques due to its hydrophobic nature and membrane-protein characteristics. The most successful approach involves heterologous expression in E. coli systems with an N-terminal His-tag fusion to facilitate purification . The full-length protein (120 amino acids) can be expressed using codon-optimized synthetic genes cloned into expression vectors with strong promoters such as T7.

For optimal expression, BL21(DE3) or C41(DE3) E. coli strains specially designed for membrane protein expression should be used. Induction with IPTG at lower temperatures (16-18°C) for extended periods (16-20 hours) helps reduce inclusion body formation and increases the yield of properly folded protein. Membrane fractionation using differential centrifugation followed by solubilization with mild detergents such as n-dodecyl-β-D-maltoside (DDM) or LDAO is critical for extracting the membrane-integrated ndhC protein without denaturing its structure.

Purification can be effectively achieved using immobilized metal affinity chromatography (IMAC) with Ni-NTA resins, followed by size exclusion chromatography to obtain homogeneous protein preparations. The purified protein should be maintained in detergent-containing buffers, and as noted in the product specifications, addition of 5-50% glycerol (with 50% being optimal) helps maintain stability during storage at -20°C or -80°C . For structural studies, the protein can be reconstituted into proteoliposomes or nanodiscs to better mimic its native membrane environment.

How can researchers assess the functional integrity of purified ndhC protein?

Assessing the functional integrity of purified Acaryochloris marina ndhC protein requires multiple complementary approaches that evaluate both structural characteristics and enzymatic activity. Circular dichroism (CD) spectroscopy provides valuable information about secondary structure content, confirming proper folding of the transmembrane helices that are essential for function. Intrinsic tryptophan fluorescence spectroscopy can be used to monitor the tertiary structure and detect conformational changes upon substrate binding.

NADH/NADPH oxidation assays serve as the primary functional test, measuring the protein's ability to catalyze electron transfer from NAD(P)H to various quinone analogs such as ubiquinone-1 or decylubiquinone. This activity can be monitored spectrophotometrically by tracking the decrease in absorbance at 340 nm, corresponding to NAD(P)H oxidation. The specific activity (μmol NADH oxidized/min/mg protein) under standardized conditions provides a quantitative measure of functional integrity.

Electron paramagnetic resonance (EPR) spectroscopy can detect the formation of semiquinone intermediates during the catalytic cycle, offering insights into the electron transfer mechanism. Additionally, reconstitution of purified ndhC with other NDH-1 complex components in proteoliposomes allows assessment of proton translocation activity using pH-sensitive fluorescent dyes or electrode-based methods. Integration of these approaches provides a comprehensive evaluation of protein functionality that correlates with structural integrity.

What are the energy transfer dynamics in A. marina's photosystem I compared to conventional cyanobacteria?

The energy transfer dynamics in Acaryochloris marina's photosystem I exhibit several distinctive features compared to conventional cyanobacteria, primarily due to its chlorophyll d-dominated light-harvesting system. Despite utilizing lower-energy far-red light, A. marina's PSI generates reducing power almost equivalent to that produced by chlorophyll a-based systems in other organisms . This remarkable efficiency stems from unique adaptations in its electron transfer pathways and energetics.

The midpoint oxidation-reduction potential of P740 in A. marina has been determined to be +335 mV , which differs from the potential of P700 in conventional cyanobacteria. This adjustment helps compensate for the lower excitation energy provided by far-red light (740 nm = 1.68 eV compared to 700 nm = 1.77 eV). The presence of pheophytin a as the primary electron acceptor represents another adaptation that optimizes the energetics of initial charge separation .

Time-resolved spectroscopy reveals that the electron transfer rates between cofactors in A. marina's PSI are carefully tuned to prevent energy loss through back reactions. The recovery kinetics of P740 after excitation (t1/e of 40 ms at 15°C) can be modulated by various electron acceptors and donors, indicating flexible electron transfer pathways . The spatial arrangement of electron carriers into two branches (A and B) related by a pseudo-C2 axis provides redundancy and enhances the robustness of the electron transfer system . These specialized energy transfer dynamics represent evolutionary adaptations that allow A. marina to thrive in far-red light environments.

What methodological approaches can be used to study ndhC interactions with other photosynthetic components?

Investigating the interactions between Acaryochloris marina's ndhC protein and other photosynthetic components requires sophisticated methodological approaches that preserve the native-like membrane environment while enabling precise measurement of molecular interactions. Co-immunoprecipitation with antibodies against ndhC or its interaction partners can identify stable protein complexes, while chemical cross-linking followed by mass spectrometry provides information about spatial proximity between proteins in the NDH-1 complex.

Surface plasmon resonance (SPR) and microscale thermophoresis (MST) offer quantitative measurements of binding affinities between ndhC and potential interaction partners when at least one component can be immobilized or fluorescently labeled. For membrane proteins like ndhC, these techniques can be adapted using detergent-solubilized proteins or reconstituted proteoliposomes. Förster resonance energy transfer (FRET) between fluorescently labeled proteins provides in vitro and potentially in vivo evidence of protein-protein interactions with spatial resolution.

Cryo-electron microscopy has emerged as a powerful technique for visualizing membrane protein complexes at near-atomic resolution, as demonstrated by the successful determination of A. marina's PSI structure at 2.58 Å resolution . This approach could potentially resolve the structure of the entire NDH-1 complex containing ndhC. Computational approaches, including molecular docking and molecular dynamics simulations, complement experimental methods by predicting interaction interfaces and the effects of mutations on complex stability. The integration of these diverse methodologies provides a comprehensive understanding of how ndhC participates in the unique photosynthetic apparatus of A. marina.

How should researchers design experiments to compare electron transport in A. marina versus conventional photosynthetic organisms?

Designing rigorous comparative studies of electron transport between Acaryochloris marina and conventional photosynthetic organisms requires careful standardization of experimental conditions and measurement techniques. Researchers should isolate thylakoid membranes or purified photosystems from both A. marina and model organisms such as Synechococcus sp. using identical protocols to minimize preparation-induced artifacts. When comparing whole-cell measurements, cultures should be grown under matched conditions, accounting for different light requirements (far-red for A. marina, red/blue for conventional cyanobacteria).

The use of artificial electron donors (such as ascorbate) and acceptors (methyl viologen, Safranin) with defined redox potentials enables precise manipulation of electron flow pathways for comparative analysis . Fluorescence measurements, including pulse-amplitude modulation (PAM) fluorometry, can assess parameters such as quantum yield and non-photochemical quenching in both systems. For in-depth analysis, isotope labeling combined with mass spectrometry can track the flow of electrons through different pathways, revealing unique aspects of A. marina's photosynthetic machinery.

What protocols are most effective for isolating intact photosystem I complexes from A. marina?

The isolation of intact photosystem I complexes from Acaryochloris marina requires specialized protocols that preserve the delicate architecture of these membrane-bound multiprotein assemblies. Based on established methodologies, the following optimized protocol yields highly pure and functionally active PSI complexes:

  • Cell cultivation should be performed in K+SM medium at 28°C and pH 8.0 with gentle aeration under moderate light intensity (25 μmol m⁻² s⁻¹), harvesting cells during the late exponential growth phase .

  • Cell disruption is most effective using a Bead-Beater with 0.2-mm glass beads in a protective buffer containing 20 mM Bis-Tris (pH 7.0), 20% glycerol, and protease inhibitors (2 mM EDTA-Na₂, 2 mM benzamidine, 2 mM phenylmethylsulfonyl fluoride) .

  • Differential centrifugation separates unbroken cells (6,600 × g for 10 min) from thylakoid membranes, which are then pelleted at high speed (165,000 × g for 40 min) .

  • Selective solubilization of thylakoid membranes using mild detergents such as n-dodecyl-β-D-maltoside (DDM) at carefully optimized detergent-to-chlorophyll ratios releases PSI complexes while maintaining their structural integrity.

  • Fractionation by sucrose density gradient ultracentrifugation or ion exchange chromatography separates PSI from other photosynthetic complexes based on size or charge differences.

  • Final purification by size exclusion chromatography yields homogeneous PSI preparations that maintain long-term stability (up to 5 days) when stored with appropriate protectants and antioxidants.

The success of this protocol can be verified by absorption spectroscopy, confirming the characteristic far-red absorption peak of chlorophyll d-containing PSI at approximately 740 nm, and by SDS-PAGE analysis to identify the 11 constituent subunits .

What analytical techniques can resolve the distinct spectral properties of chlorophyll d versus chlorophyll a in mixed samples?

Resolving the distinct spectral properties of chlorophyll d versus chlorophyll a in mixed samples requires a combination of specialized analytical techniques that exploit their different physical and chemical characteristics. High-performance liquid chromatography (HPLC) with diode array detection provides effective separation based on the slight differences in polarity between these pigments, with chlorophyll d typically eluting earlier than chlorophyll a when using reverse-phase columns. The addition of mass spectrometry detection (HPLC-MS) enables unambiguous identification based on molecular weights (chlorophyll a: 893.5 g/mol; chlorophyll d: 895.5 g/mol).

Absorption spectroscopy in different solvents reveals distinctive features for quantitative analysis. In methanol, chlorophyll d exhibits a Qy band maximum at approximately 697 nm, while chlorophyll a absorbs maximally at 665.2 nm . This 30-nm difference provides a basis for dual-wavelength methods to determine relative concentrations in mixed samples. Fluorescence excitation and emission spectroscopy offer enhanced sensitivity for detecting small amounts of either pigment, as they have distinguishable emission maxima.

Resonance Raman spectroscopy can differentiate between these chlorophylls based on their vibrational properties, particularly those associated with the formyl group at the C3 position in chlorophyll d versus the vinyl group in chlorophyll a. For structural characterization within protein complexes, circular dichroism spectroscopy reveals differences in how these pigments interact with their protein environment. Nuclear magnetic resonance (NMR) spectroscopy provides the ultimate confirmation of molecular structure when higher concentrations of purified pigments are available.

How should researchers interpret differences in midpoint potentials between A. marina and conventional photosystems?

The interpretation of midpoint potential differences between Acaryochloris marina and conventional photosystems requires careful consideration of thermodynamic principles and the energetic constraints of photosynthesis. The measured midpoint potential of +335 mV for P740 in A. marina represents a critical adaptation that compensates for the lower excitation energy available from far-red light absorption. Researchers should analyze these differences within the framework of the entire electron transport chain rather than as isolated values.

When comparing midpoint potentials, it's essential to maintain consistent experimental conditions, including pH, temperature, and ionic strength, as these factors significantly influence redox measurements. Standardized techniques such as potentiometric titrations coupled with spectroscopic monitoring provide the most reliable comparative data. The analysis should account for the differing pigment compositions, as the replacement of chlorophyll a with chlorophyll d in the special pair inherently affects the electronic structure and thus the redox properties.

The functional significance of midpoint potential differences should be evaluated in terms of the free energy available for downstream processes. Despite utilizing lower-energy photons (740 nm = 1.68 eV versus 700 nm = 1.77 eV), A. marina's photosystem I generates reducing power almost equivalent to conventional systems . This apparent paradox is resolved by considering the integrated operation of the entire electron transport chain, where adjustments in multiple redox components collaboratively maintain efficient energy conversion. Computational modeling of electron transfer rates using Marcus theory can provide theoretical validation of experimentally observed differences.

What statistical approaches are appropriate for analyzing spectroscopic data from A. marina photosystems?

Analyzing spectroscopic data from Acaryochloris marina photosystems requires sophisticated statistical approaches that account for the complex, multicomponent nature of biological spectra. Component analysis techniques, particularly Singular Value Decomposition (SVD) and Principal Component Analysis (PCA), effectively separate overlapping spectral signatures from different chlorophyll species and reaction center components. These methods identify the minimum number of distinct spectral components needed to describe the complete dataset, revealing contributions from chlorophyll d, chlorophyll d', pheophytin a, and other cofactors.

For time-resolved spectroscopic data, global and target analysis using kinetic modeling provides insights into the rates and pathways of energy and electron transfer. These approaches fit multiple wavelengths simultaneously with shared kinetic parameters, yielding species-associated difference spectra (SADS) or evolution-associated difference spectra (EADS) that characterize intermediate states in the photochemical process. The observation of a 40 ms recovery time constant for P740 can be rigorously analyzed using such methods to extract information about electron transfer dynamics.

Bayesian statistical frameworks offer advantages for comparing alternative kinetic models when analyzing complex spectroscopic data, as they incorporate prior knowledge and provide robust uncertainty estimates. When comparing spectroscopic properties between A. marina and conventional photosystems, multivariate analysis of variance (MANOVA) or permutation-based statistical tests determine the significance of observed differences while accounting for the multivariate nature of spectroscopic datasets. These sophisticated statistical approaches transform complex spectral data into mechanistic insights about A. marina's unique photochemistry.

How can researchers differentiate between direct and indirect effects of ndhC mutations on photosynthetic performance?

Differentiating between direct and indirect effects of ndhC mutations on photosynthetic performance requires a multifaceted experimental approach that systematically isolates various aspects of photosynthetic function. Site-directed mutagenesis of conserved residues in ndhC should be complemented by the creation of a complete deletion mutant to establish baseline effects. Comparative growth analysis under different light conditions (intensity and spectral quality) and carbon sources provides initial insights into phenotypic consequences.

To distinguish direct from indirect effects, researchers should implement a hierarchical analysis approach:

Statistical approaches such as path analysis or structural equation modeling can integrate these diverse datasets to quantify direct and indirect causal relationships between ndhC mutations and various aspects of photosynthetic performance.

What are the most promising applications of A. marina's unique photosynthetic machinery in synthetic biology?

The unique photosynthetic machinery of Acaryochloris marina, particularly its ability to utilize far-red light, presents several promising applications in synthetic biology. Engineering plants or cyanobacteria to incorporate chlorophyll d and key components from A. marina could extend the photosynthetically active radiation (PAR) range into the far-red region, potentially increasing photosynthetic efficiency in natural or artificial light conditions. This approach could significantly enhance crop productivity by capturing previously unused portions of the solar spectrum, especially in lower canopy layers where far-red light penetrates more effectively.

Bioengineered photosynthetic systems incorporating ndhC and other components from A. marina's electron transport chain could power bioremediation applications in low-light environments, such as deep water bodies or shaded contaminated sites. The lower energy requirements of A. marina's photosystems also suggest potential advantages for engineered bioproduction systems operating under energy-limited conditions, offering more efficient conversion of light energy into valuable biomolecules.

For bioenergy applications, synthetic incorporation of A. marina's photosynthetic components into hydrogen-producing organisms could extend productive hydrogen evolution into far-red illumination conditions. Additionally, biosensors based on the redox-sensitive components of A. marina's photosystems could provide sensitive detection systems for environmental monitoring applications, particularly under low-light conditions. These diverse applications represent the translation of fundamental knowledge about A. marina's unique photosynthetic adaptations into practical biotechnological solutions.

What technical challenges remain in resolving the complete structure of the NDH-1 complex containing ndhC in A. marina?

Despite significant advances in structural biology techniques, resolving the complete structure of the NDH-1 complex containing ndhC in Acaryochloris marina faces several formidable technical challenges. The inherent membrane-embedded nature of this large multiprotein complex makes it difficult to extract and purify while maintaining native structural integrity. Current detergent-based solubilization methods often disrupt critical lipid-protein interactions that stabilize the complex, while newer approaches using styrene-maleic acid copolymers (SMAs) or nanodiscs require extensive optimization for each specific membrane protein complex.

The dynamic nature of the NDH-1 complex presents another challenge, as conformational changes during the catalytic cycle create structural heterogeneity that complicates single-particle cryo-electron microscopy analysis. The relatively low expression levels of NDH-1 components compared to photosystems in cyanobacteria make it difficult to obtain sufficient quantities of purified complex for structural studies. Additionally, the hydrophobicity of subunits like ndhC increases their tendency to aggregate during concentration steps necessary for structural determination.

Current technical limitations in cryo-EM sample preparation, particularly issues with preferred orientation of membrane proteins in vitreous ice, can prevent the collection of images from all necessary viewing angles. The success achieved with A. marina's PSI structure determination at 2.58 Å resolution provides a methodological template, but the NDH-1 complex presents additional challenges due to its larger size and more complex subunit composition. Hybrid approaches combining cryo-EM with complementary techniques such as crosslinking mass spectrometry and computational modeling may be necessary to resolve the complete structure of this challenging but crucial photosynthetic complex.

How might climate change and shifting light environments affect the ecological niche of A. marina and similar far-red light utilizing organisms?

Ocean acidification may indirectly influence the success of A. marina by altering the composition and density of biological communities that create the specific microhabitats where this organism thrives. A. marina was initially discovered growing on colonial ascidians beneath didemnid ascidians containing Prochloron, an environmental niche where predominantly far-red light was available . Changes in calcification and distribution of such organisms due to ocean acidification could significantly impact these specialized habitats.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.