Recombinant Acaryochloris marina Photosystem Q (B) protein 1

Shipped with Ice Packs
In Stock

Description

Introduction to Acaryochloris Marina and Its Photosystems

Acaryochloris marina is a distinctive cyanobacterium that has attracted significant scientific attention due to its unique photosynthetic properties. Unlike most photosynthetic organisms that primarily utilize chlorophyll a, A. marina predominantly contains chlorophyll d as its major photosynthetic pigment . This unusual characteristic enables the organism to efficiently harness far-red light for photosynthesis, allowing it to occupy specialized ecological niches where traditional chlorophyll a-containing organisms struggle to perform photosynthesis .

The photosynthetic apparatus of A. marina consists of two main photosystems: Photosystem I (PSI) and Photosystem II (PSII). These large protein supercomplexes work in tandem to facilitate the conversion of light energy into chemical energy. PSI in A. marina has been characterized as having 11 polypeptide subunits, including the unique Psa27 subunit, and contains primarily chlorophyll d molecules . The primary electron donor in PSI of A. marina (P740) absorbs maximally at 740 nm, which is at a longer wavelength compared to the P700 found in chlorophyll a-containing organisms .

PSII in A. marina has also evolved specialized adaptations. Studies have shown that the energetics of charge recombination are modified in A. marina PSII, leading to approximately a 15 meV decrease in the free energy gap between the Q(A) and Q(B) electron acceptors compared to chlorophyll a-containing cyanobacteria . Additionally, the total free energy gap between the ground state and the excited state of the reaction center chlorophyll is at least 25-30 meV smaller in A. marina, suggesting contributions from chlorophyll d in the primary donor species .

Genetic Features of psbA1 in A. Marina

The genome of A. marina contains three copies of the psbA gene, which encode two distinct D1 isoforms . The psbA1 gene (AM1_0448) encodes the Photosystem Q(B) protein 1, which belongs to the recently identified D1′ group of cyanobacteria . The other two psbA genes, AM1_2166 (psbA2) and AM1_2889 (psbA3), encode identical D1 proteins that are classified as D1m isoforms .

The psbA1 gene product is notably different from the other two D1 proteins in A. marina. While psbA2 and psbA3 share 97% nucleotide and 100% amino acid identity with each other, psbA1 shares only 61% amino acid identity with them . Interestingly, the D1 protein encoded by psbA1 is more closely related to divergent PsbA proteins found in other cyanobacteria such as Anabaena variabilis (YP_324615) and Crocosphaera watsonii (ZP_00515211) .

This genetic diversity within the psbA gene family in A. marina suggests specialized roles for each D1 variant, potentially allowing the organism to adapt to different light conditions or environmental stresses. The presence of multiple psbA genes is a common feature in cyanobacteria, but the specific divergence pattern observed in A. marina provides insights into the evolutionary adaptations of its photosynthetic apparatus.

Recombinant Production and Properties

The recombinant form of Acaryochloris marina Photosystem Q(B) protein 1 has been successfully produced using E. coli expression systems. The commercially available recombinant protein is fused with an N-terminal His-tag to facilitate purification and is expressed as the full-length protein comprising all 348 amino acid residues . This approach allows for the production of significant quantities of the protein for research purposes while maintaining its structural integrity.

The recombinant protein is typically provided as a lyophilized powder with a purity greater than 90% as determined by SDS-PAGE . The storage buffer consists of a Tris/PBS-based solution containing 6% trehalose at pH 8.0, which helps maintain protein stability during storage . For reconstitution, it is recommended to dissolve the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with the addition of 5-50% glycerol for long-term storage at -20°C or -80°C .

Functional Significance in Photosynthesis

The D1 protein, including the variant encoded by psbA1 in A. marina, plays a pivotal role in photosynthesis as it forms part of the reaction center of PSII. This protein binds various cofactors involved in electron transport, including chlorophylls, pheophytins, and quinones. Specifically, it binds the plastoquinone molecules Q(A) and Q(B), with the latter giving rise to the protein's name: Photosystem Q(B) protein .

In the context of A. marina's unique photosynthetic characteristics, the D1 protein must accommodate the organism's predominant use of chlorophyll d instead of chlorophyll a. Despite the differences in chlorophyll composition, the primary sequence of both D1 and D2 proteins in A. marina is highly conserved compared to other cyanobacteria, suggesting that chlorophyll d likely binds naturally to the same sites that would normally bind chlorophyll a .

Studies on PSII function in A. marina have revealed modifications in the energetics of charge recombination compared to chlorophyll a-containing cyanobacteria like Synechocystis PCC 6803 . These differences include a decrease in the free energy gap between Q(A) and Q(B) acceptors and a smaller total free energy gap between the ground state and the excited state of the reaction center chlorophyll . These modifications are likely adaptations that allow A. marina to efficiently utilize far-red light for photosynthesis.

The unique properties of the D1 protein encoded by psbA1 may contribute to these adaptations, potentially providing A. marina with specialized photosynthetic capabilities under specific environmental conditions. The D1′ group to which this protein belongs has been associated with specific functional adaptations in other cyanobacteria, further supporting this hypothesis .

Comparison with Related Proteins

The Photosystem Q(B) protein 1 of A. marina shares structural and functional similarities with D1 proteins from other photosynthetic organisms but also exhibits unique features that reflect its evolutionary adaptations. As a member of the D1′ group of cyanobacterial proteins, it contains specific amino acid changes that distinguish it from the more common D1 variants .

When comparing the three D1 proteins in A. marina, the psbA1-encoded protein stands apart from the other two, which are nearly identical to each other . This divergence suggests specialized roles for each variant, possibly allowing for differential expression under varying environmental conditions or developmental stages.

The conservation of the primary sequence of D1 proteins across different organisms, despite variations in chlorophyll content, is a testament to the fundamental importance of this protein in photosynthesis. The fact that chlorophyll d can apparently bind to sites typically occupied by chlorophyll a in other organisms highlights the flexibility of the protein structure to accommodate different pigments while maintaining its essential functions .

In PSI of A. marina, a unique reaction center has been identified that contains photosynthetic pigments dominated by chlorophyll d . This PSI structure, determined at 3.3 Å resolution using cryo-electron microscopy, revealed a trimeric organization with three identical monomers . Surprisingly, the primary electron acceptor A0 in this PSI complex is composed of two pheophytin a molecules rather than chlorophyll a as found in other well-known PSI structures . This finding highlights the unique adaptations of the photosynthetic apparatus in A. marina.

Research Applications and Future Directions

Recombinant Acaryochloris marina Photosystem Q(B) protein 1 represents a valuable tool for investigating the structural and functional aspects of photosynthesis in this unique cyanobacterium. The availability of the purified recombinant protein facilitates various biochemical and biophysical studies, including:

  1. Structure-function analysis of the D1 protein in the context of chlorophyll d-based photosynthesis

  2. Comparative studies with D1 proteins from chlorophyll a-containing organisms

  3. Investigation of protein-pigment interactions in reconstituted systems

  4. Analysis of electron transfer kinetics and energetics

  5. Exploration of the protein's role in adaptation to far-red light environments

Future research directions may include:

  1. Determining the high-resolution structure of the PSII complex containing this specific D1 variant

  2. Investigating the regulation of psbA1 expression under different environmental conditions

  3. Exploring the potential for engineering plants or algae with enhanced far-red light absorption capabilities based on insights from A. marina photosystems

  4. Studying the interactions between the D1 protein and other components of PSII to understand the assembly and maintenance of the photosynthetic apparatus

  5. Examining the evolutionary history of this divergent D1 variant and its relationship to the acquisition of chlorophyll d-based photosynthesis

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, should you have specific format requirements, please indicate them when placing your order, and we will fulfill your request accordingly.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are standardly shipped with regular blue ice packs. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's intrinsic stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be decided during production. If you have a preferred tag type, please inform us, and we will prioritize developing it for your product.
Synonyms
psbA1; AM1_0448; Photosystem II protein D1 1; PSII D1 protein 1; Photosystem II Q(B protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-348
Protein Length
full length protein
Species
Acaryochloris marina (strain MBIC 11017)
Target Names
psbA1
Target Protein Sequence
MSTTFQTPSRLPTVSAWDQFCEWITSTHNRLYVGWFGLLMIPSLFVSAITFMLAWVAAPS VDMEGIREPIISSLLGGSNVITAAVIPTSAAIGLHLYPLWEATSMDEWLYNGGPYQLIIL HFLIAIWTYLGRQWELSYRLGMRPWIAMAFSAPVAAATAVLLVYPMGQGSFSEGLPLGIS GTFHFMMAVQAEHNILMHPFHMLGVVGVFGGAFLSAMHGSLVTSSLVQETSSLKSVNTGY KFGQQEATYNLLAGHAGYLGRLFIPDIAFRNSRSIHFLLAVLPTIGIWFAALGIGTMAFN LNGFNFNHSLLDSSGRPIRTEADLLNRATMGLQVMHSVNAHHFSLTLA
Uniprot No.

Target Background

Function
Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase that harnesses light energy to extract electrons from H(2)O, producing O(2) and a proton gradient subsequently utilized for ATP synthesis. It comprises a core antenna complex that captures photons and an electron transfer chain that converts photonic excitation into charge separation. The D1/D2 (PsbA/PsbA) reaction center heterodimer binds P680, the primary electron donor of PSII, along with several subsequent electron acceptors.
Database Links
Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Cellular thylakoid membrane; Multi-pass membrane protein.

Q&A

What makes Acaryochloris marina's photosynthetic apparatus unique among cyanobacteria?

Acaryochloris marina stands out as one of the few cyanobacterial species capable of utilizing far-red light (700-750 nm) for oxygenic photosynthesis. This adaptation is primarily due to its use of chlorophyll d as the predominant photosynthetic pigment rather than chlorophyll a that is typical in most oxygenic phototrophs . The organism has been isolated from marine environments where it lives in association with other photosynthetic organisms, suggesting that its chlorophyll d adaptation represents a niche-filling evolutionary strategy to capture light wavelengths not utilized by competing organisms . This adaptation allows A. marina to thrive in environments where far-red light predominates, giving it a competitive advantage in specific ecological niches.

How does the structure of Acaryochloris marina's photosystem I differ from typical cyanobacterial PSI?

The photosystem I (PSI) reaction center of A. marina, resolved at 2.58 Å resolution using cryo-electron microscopy, reveals several distinctive structural features. The PSI complex consists of 11 subunits with an arrangement of electron carriers and light-harvesting pigments that differs significantly from other type I reaction centers . Most notably, the special pair (P740) is composed of a dimer of chlorophyll d and its epimer chlorophyll d', rather than the chlorophyll a dimers found in typical cyanobacteria . Additionally, the primary electron acceptor in A. marina PSI is pheophytin a, a metal-less chlorin, which represents another departure from conventional PSI structures . These structural modifications are critical adaptations that enable efficient photochemistry despite the lower energy yield from far-red light photons.

What are the key components of the electron transport chain in Acaryochloris marina photosystems?

The electron transport chain in A. marina includes several key components that have been identified through structural and functional studies. In photosystem I, electron transfer begins at the special pair (P740), consisting of chlorophyll d/d' dimers, and progresses through pheophytin a as the primary electron acceptor . In photosystem II, the water oxidizing complex (WOC) functions with parameters similar to those of conventional PSII systems, despite the presence of chlorophyll d . The electron transport chain includes quinone electron acceptors, with QA serving as the primary stable electron acceptor and QB as the secondary quinone acceptor that, once fully reduced, detaches from the reaction center to deliver electrons to the cytochrome b6f complex . Studies of fluorescence decay kinetics indicate that the electron transfer from QA- to QB/QB- proceeds with kinetics that differ somewhat from those observed in chlorophyll a-containing organisms .

What techniques are most effective for isolating intact photosystem complexes from Acaryochloris marina?

Isolation of intact photosystem complexes from A. marina requires specialized techniques due to the unique pigment composition and membrane organization in this organism. Based on published research methodologies, the most effective approach involves:

  • Cell disruption: Gentle mechanical disruption using glass beads or a French press under dim far-red light conditions to prevent photodamage to the chlorophyll d-enriched complexes.

  • Differential centrifugation: Sequential centrifugation steps to separate thylakoid membranes from other cellular components.

  • Detergent solubilization: Careful selection of detergents (typically n-dodecyl-β-D-maltoside or digitonin) at concentrations optimized for A. marina membranes.

  • Density gradient ultracentrifugation: Using 10-30% sucrose gradients to separate intact PSI and PSII complexes while maintaining their native configurations.

  • Column chromatography: Ion-exchange or size-exclusion chromatography for final purification steps.

Throughout the isolation process, samples should be protected from strong visible light and maintained at 4°C to preserve the integrity of the chlorophyll d molecules. Validation of complex integrity can be performed using absorption spectroscopy, monitoring the characteristic far-red absorption bands of chlorophyll d (around 710-720 nm) .

How can researchers accurately measure electron transfer kinetics between QA and QB in Acaryochloris marina PSII?

Measuring electron transfer kinetics between QA and QB in A. marina requires specialized approaches due to the red-shifted absorption and fluorescence properties of chlorophyll d. Based on the literature, the following methodological approach is recommended:

  • Chlorophyll fluorescence decay measurements: Using pulse-amplitude modulated fluorescence techniques with far-red measuring light (~730-750 nm) to track QA redox state changes. The decay kinetics after a single turnover flash reveal information about electron transfer from QA- to QB .

  • DCMU inhibition studies: Comparing fluorescence decay kinetics in the presence and absence of DCMU (3-(3,4-dichlorophenyl)-1,1-dimethylurea), which blocks electron transfer from QA to QB. This allows discrimination between forward electron transfer and charge recombination pathways .

  • Thermoluminescence measurements: Recording the temperature-dependent luminescence from S2QA- recombination to determine energy gaps between electron transport components .

  • Time-resolved spectroscopy: Using far-red sensitive detectors to monitor absorption changes in the microsecond-to-second time range that correlate with quinone reduction states.

Analysis of QA to QB electron transfer in A. marina has revealed distinctive features compared to chlorophyll a-containing organisms. For example, fluorescence decay measurements show multiple kinetic phases, with the middle phase (T2) having time constants of approximately 4-20 ms, reflecting the forward electron transfer from QA- to QB/QB- . The slower phase (T3) with time constants of 5-15 seconds corresponds to charge recombination between QA- and the S2 state of the manganese cluster in centers where forward electron transfer to QB did not occur .

What experimental approaches can distinguish between chlorophyll d and chlorophyll a functions in Acaryochloris marina reaction centers?

Distinguishing between the functions of chlorophyll d and the minor amounts of chlorophyll a in A. marina reaction centers requires sophisticated experimental approaches:

  • Site-directed mutagenesis: Modifying amino acid residues that provide ligands to specific chlorophyll molecules to alter binding specificity or affinity.

  • Pigment exchange experiments: Developing protocols to selectively replace chlorophyll d with chlorophyll a (or vice versa) in isolated reaction centers.

  • High-resolution spectroscopy: Using techniques such as transient absorption spectroscopy with femtosecond time resolution to track energy and electron transfer pathways among different pigments.

  • Low-temperature (77K) fluorescence spectroscopy: Measuring emission spectra to identify energy transfer relationships between different chlorophyll species.

  • Circular dichroism spectroscopy: Analyzing the interactions between pigments in their protein environment to determine structural arrangements.

  • Computational modeling: Using the high-resolution structural data (2.58 Å) to model energy transfer and electron transport pathways, with particular attention to special pair (P740) properties .

Research has shown that while chlorophyll d predominates in A. marina photosystems, the few chlorophyll a molecules present may play specialized roles, particularly in the electron transfer chain. The methodologies above help elucidate these distinct functional roles.

How does the energy gap between QA- and pheophytin in Acaryochloris marina compare to conventional photosystems?

The energy gap between QA- and pheophytin in Acaryochloris marina's chlorophyll d-containing photosystem II (Chl-d-PSII) differs significantly from that in conventional chlorophyll a-containing PSII (Chl-a-PSII) and chlorophyll f-containing PSII (Chl-f-PSII). Research indicates that Chl-d-PSII has a smaller energy gap between QA- and pheophytin compared to both Chl-a-PSII and Chl-f-PSII .

This smaller energy gap results in two observable phenomena:

  • Lower thermoluminescence peak temperature: Less thermal energy is required for the electron to be transferred energetically uphill from QA- to pheophytin, manifesting as a lower thermoluminescence peak temperature .

  • Faster S2QA- luminescence decay kinetics: A larger proportion of S2QA- recombination occurs via repopulation of P+Phe-, which is a faster route than direct P+QA- recombination .

Interestingly, despite these differences in energy gap and recombination pathways, the QA- decay rate as monitored by fluorescence does not show marked increases in Chl-d-PSII compared to other photosystems. This suggests differences in the competition between radiative and non-radiative recombination pathways in Chl-d-PSII .

These energy gap differences likely represent adaptations that allow A. marina to efficiently utilize the lower energy of far-red photons while maintaining effective charge separation and electron transport.

What is known about the QB binding pocket in Acaryochloris marina photosystem II?

While the high-resolution structure of A. marina photosystem II QB binding pocket has not been fully characterized to the same extent as its PSI, comparative analyses with other cyanobacterial species provide insights into its likely structure and function. The QB binding pocket in PSII typically lies within the D1 protein and consists of a hydrophobic cavity that accommodates the plastoquinone molecule.

Functional studies of electron transfer in A. marina PSII suggest that the QB binding pocket maintains structural features similar to conventional PSII systems, as evidenced by:

  • DCMU sensitivity: The effective inhibition of electron transfer from QA to QB by DCMU indicates a conserved binding pocket structure that can accommodate this herbicide .

  • Electron transfer kinetics: The observed kinetics of electron transfer from QA- to QB, with time constants in the millisecond range, are consistent with a functional QB binding site .

  • Genomic analysis: The A. marina genome (8.3 million base pairs) contains genes encoding PSII components with high homology to conventional systems, suggesting structural conservation of functional domains including the QB binding pocket .

The functional data indicates that despite adaptation to far-red light and the predominance of chlorophyll d, A. marina has maintained a QB binding pocket that supports efficient electron transport from QA to the plastoquinone pool. This conservation likely reflects the fundamental importance of this electron transfer step in photosynthetic energy conversion.

How does the water oxidizing complex in Acaryochloris marina compare to that in chlorophyll a-containing cyanobacteria?

Comparative analysis of the water oxidizing complex (WOC) in A. marina and chlorophyll a-containing cyanobacteria reveals striking functional similarities despite the differences in primary photosynthetic pigments. Research on A. marina's WOC has shown:

  • Similar S-state transition probabilities: The light-induced oxidative state transitions in A. marina's WOC demonstrate miss probabilities comparable to those observed in spinach thylakoids, suggesting conserved photochemical efficiency .

  • Conserved redox potentials: Analysis within the framework of different versions of the Kok model indicates that the redox potentials within the WOC, reaction center (P680), and the redox-active tyrosine YZ are virtually identical between A. marina and conventional photosystems .

  • Similar S2 and S3 state lifetimes: Lifetime measurements of the S2 and S3 states revealed virtually identical time constants for the slow phase of deactivation between A. marina and spinach thylakoids .

  • Differences in YD function: Kinetic differences in the fast phase of S2 and S3 decay between A. marina cells and spinach thylakoids reflect a shift of the Em of YD/YDox to lower values in A. marina, as evidenced by an opposite change in the kinetics of S0→S1 transition mediated by YDox .

These findings suggest that despite A. marina's adaptation to far-red light and its use of chlorophyll d instead of chlorophyll a, the fundamental machinery of water oxidation has remained highly conserved. This conservation likely reflects the critical importance of maintaining efficient water-splitting chemistry regardless of the specific chlorophyll type used for light harvesting.

What genomic features enable Acaryochloris marina to synthesize and utilize chlorophyll d?

The genomic analysis of A. marina provides insights into the unique features that enable this cyanobacterium to synthesize and utilize chlorophyll d as its predominant photosynthetic pigment. Key genomic features include:

These genomic features collectively support the niche adaptation of A. marina to far-red light environments, making it an excellent model organism for studying genome expansion, gene acquisition, ecological adaptation, and photosystem modification in cyanobacteria .

How have the genes encoding QB-binding proteins evolved in Acaryochloris marina compared to other cyanobacteria?

While the search results don't provide specific details about the evolution of QB-binding protein genes in A. marina, we can infer some aspects of their evolution based on the general genomic characteristics and photosystem properties described.

The evolution of QB-binding proteins in A. marina likely reflects a balance between conservation of essential electron transport functions and adaptation to the unique spectral properties of chlorophyll d. Several evolutionary patterns can be inferred:

  • Functional conservation: The similar electron transfer kinetics and DCMU sensitivity observed in A. marina compared to conventional photosystems suggest strong selective pressure to maintain functional QB binding and electron transfer capabilities .

  • Genomic context: The unusually large genome of A. marina (8.3 million base pairs) with extensive gene duplication provides a genetic background conducive to protein evolution while maintaining essential functions .

  • Minimal specialization: Analysis of the A. marina genome indicates that "global replacement of major photosynthetic pigments appears to have incurred only minimal specializations in reaction center proteins to accommodate these alternate pigments" . This suggests that QB-binding proteins likely maintain high sequence and structural homology with their counterparts in other cyanobacteria, with only subtle modifications to accommodate the altered electronic properties of chlorophyll d.

  • Convergent evolution: The functional similarity of A. marina's electron transport components to those in conventional photosystems, despite the different pigment environment, suggests potential convergent evolution toward optimal electron transfer parameters regardless of the specific chlorophyll type used.

Future comparative genomic and structural studies focusing specifically on the QB-binding regions of photosystem II in A. marina and other cyanobacteria would provide more detailed insights into the evolutionary trajectories of these critical proteins.

What are the major challenges in expressing recombinant Acaryochloris marina photosystem proteins in heterologous systems?

Expression of recombinant A. marina photosystem proteins, particularly those involved in QB binding and electron transport, presents several technical challenges in heterologous systems:

  • Chlorophyll d requirement: A. marina photosystem proteins have evolved to function with chlorophyll d, which is not naturally produced in common expression hosts like E. coli or yeast. This creates a fundamental challenge in producing functional proteins.

  • Membrane protein expression: Photosystem proteins, including QB-binding proteins, are integral membrane proteins that require specialized expression systems capable of proper membrane insertion and folding.

  • Multi-subunit complex assembly: Photosystems are complex multi-subunit assemblies. Expressing individual components without their native interaction partners may result in improper folding or instability.

  • Post-translational modifications: Any post-translational modifications specific to A. marina would be absent in heterologous systems, potentially affecting protein function.

  • Codon usage bias: The high GC content and unique codon usage patterns in A. marina may necessitate codon optimization for expression in heterologous hosts.

Potential solutions to these challenges include:

  • Co-expression systems: Developing expression systems that co-express multiple photosystem components to facilitate proper complex assembly.

  • Membrane-mimetic environments: Using specialized detergents, nanodiscs, or liposomes to provide appropriate environments for membrane protein folding.

  • Chlorophyll d supplementation: For functional studies, developing methods to supplement expression systems with chlorophyll d or to express chlorophyll d biosynthetic enzymes alongside photosystem proteins.

  • Cell-free expression systems: Using cell-free protein synthesis with supplemented chlorophyll d and membrane mimetics to overcome cellular limitations.

  • Chimeric proteins: Creating chimeric proteins with domains from well-expressed homologs to improve expression while maintaining key functional regions.

These approaches, while challenging, would enable detailed structure-function studies of A. marina photosystem components, including QB-binding proteins, in controlled experimental settings.

How can researchers distinguish between QA and QB electron acceptance events in spectroscopic measurements?

Distinguishing between QA and QB electron acceptance events in spectroscopic measurements of A. marina photosystems requires specialized techniques and careful experimental design. Based on the research methodologies described in the literature, the following approaches are recommended:

  • Differential inhibitor studies: Comparing measurements with and without specific inhibitors like DCMU, which blocks electron transfer from QA to QB, allows isolation of QA-specific signals .

  • Kinetic deconvolution: Analyzing the multi-phasic decay of chlorophyll fluorescence after a single turnover flash, where:

    • Fast phase (milliseconds): Primarily represents QA- to QB electron transfer

    • Middle phase (tens to hundreds of milliseconds): Reflects QB- formation and subsequent events

    • Slow phase (seconds): Associated with charge recombination between QA- and donor-side components

  • Temperature-dependent measurements: Thermoluminescence studies at different temperatures can separate signals from different recombination pathways, helping distinguish QA and QB involvement .

  • Flash number dependency: Analyzing how signals change with consecutive flashes can help identify QB reduction states, as two-electron reduction of QB leads to quinol formation and exchange.

  • Spectral fingerprinting: QA- and QB- may have slightly different effects on the absorption spectrum of nearby chromophores, allowing spectral discrimination.

In A. marina specifically, fluorescence decay kinetics after a single turnover flash show multiple phases with distinct time constants:

  • T1 (fast phase): ~220-390 μs, attributed to QA- reoxidation in centers where the QB site is occupied

  • T2 (middle phase): ~4-20 ms, representing QB- formation

  • T3 (slow phase): ~5-15 s, corresponding to S2QA- recombination in centers where forward electron transfer to QB did not occur

These characteristic kinetic signatures provide a means to distinguish between QA and QB-related electron transfer events in spectroscopic measurements.

What are the most promising directions for engineering Acaryochloris marina photosystems for enhanced far-red light utilization?

Based on current understanding of A. marina photosystems, several promising research directions could lead to enhanced far-red light utilization:

  • Optimizing special pair composition: Engineering the chlorophyll d/d' dimer (P740) to further red-shift its absorption while maintaining efficient charge separation properties .

  • Tuning electron transport energetics: Modifying the redox potentials of electron carriers, particularly the QA/QB system, to optimize energy conservation from the lower-energy photons of far-red light .

  • Enhancing antenna systems: Engineering the light-harvesting antenna to improve far-red light capture and energy transfer to reaction centers, potentially incorporating additional far-red absorbing pigments.

  • Reducing non-productive recombination: Modifying the energy gap between QA- and pheophytin to minimize back reactions while maintaining forward electron transfer efficiency .

  • Improving quantum yield: Engineering the water oxidizing complex to maintain high quantum efficiency despite the lower energy input from far-red photons .

  • Heterologous expression of A. marina components: Transferring key A. marina adaptations into other photosynthetic organisms to extend their light absorption range.

  • Computational design approaches: Using the high-resolution structural data (2.58 Å) as a foundation for computational modeling and rational design of improved far-red light utilizing photosystems .

These research directions could lead to photosynthetic systems with expanded spectral ranges, potentially increasing photosynthetic productivity in natural or engineered settings where far-red light predominates.

What unresolved questions remain about the QB binding pocket in Acaryochloris marina photosystem II?

Despite significant advances in understanding A. marina photosystems, several important questions remain unresolved regarding the QB binding pocket in its photosystem II:

  • High-resolution structural details: While the PSI structure has been resolved at 2.58 Å , equivalent high-resolution structural data for PSII, particularly focusing on the QB binding pocket, is still needed to understand potential adaptations to the chlorophyll d environment.

  • Plastoquinone binding dynamics: How does the binding and release of plastoquinone at the QB site differ in A. marina compared to conventional PSII systems? Are there adaptations that compensate for the potentially different redox properties resulting from the chlorophyll d environment?

  • Protonation mechanisms: What are the protonation pathways for reduced QB in A. marina PSII, and how might they differ from those in chlorophyll a-containing systems?

  • Herbicide sensitivity profile: Does the QB pocket in A. marina show altered sensitivity to various classes of herbicides that target this site compared to conventional PSII systems?

  • Evolutionary origins: Did the QB binding pocket in A. marina evolve from conventional PSII through gradual adaptation, or was it acquired through horizontal gene transfer?

  • Functional redundancy: Does A. marina possess multiple isoforms of D1 protein with different QB binding properties, as observed in some other cyanobacteria, to optimize function under varying environmental conditions?

  • Redox tuning mechanisms: How is the redox potential of QB tuned in relation to QA to maintain efficient electron transfer despite the different energetics of the chlorophyll d-based photosystem?

Addressing these questions would provide valuable insights into how nature has adapted electron transport systems to function with different photosynthetic pigments and could inform biomimetic approaches to expanding the spectral range of photosynthesis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.