Recombinant Acaryochloris marina Photosystem Q (B) protein 2

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
psbA2; AM1_2166; psbA3; AM1_2889; Photosystem II protein D1 2; PSII D1 protein 2; Photosystem II Q(B protein 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-360
Protein Length
full length protein
Species
Acaryochloris marina (strain MBIC 11017)
Target Names
psbA2
Target Protein Sequence
MTTVLQRRESASAWERFCSFITSTNNRLYIGWFGVLMIPTLLTAVTCFVIAFIGAPPVDI DGIREPVAGSLLYGNNIITGAVVPSSNAIGLHLYPIWEAASLDEWLYNGGPYQLIIFHYM IGCICYLGRQWEYSYRLGMRPWICVAYSAPLAATYSVFLIYPLGQGSFSDGMPLGISGTF NFMFVFQAEHNILMHPFHMFGVAGVLGGSLFAAMHGSLVSSTLVRETTEGESANYGYKFG QEEETYNIVAAHGYFGRLIFQYASFSNSRSLHFFLGAWPVVCIWLTAMGISTMAFNLNGF NFNHSIVDSQGNVVNTWADVLNRANLGFEVMHERNAHNFPLDLAAGESAPVALTAPVING
Uniprot No.

Target Background

Function
Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase. It utilizes light energy to extract electrons from H₂O, generating O₂ and a proton gradient for ATP synthesis. PSII comprises a core antenna complex for photon capture and an electron transfer chain converting photonic excitation into charge separation. The D1/D2 (PsbA/PsbD) reaction center heterodimer binds P680, the primary electron donor of PSII, and several subsequent electron acceptors.
Database Links
Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Cellular thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Acaryochloris marina Photosystem Q(B) protein 2 and what is its role in photosynthesis?

Acaryochloris marina Photosystem Q(B) protein 2 is a key component of photosystem II, encoded by the psbA2 gene (UniProt ID: A5A8K9) and functions as the D1 protein within the photosynthetic reaction center . This protein spans 360 amino acids and plays a crucial role in electron transport within photosystem II, specifically as the binding site for the secondary electron acceptor quinone (QB) . In the context of A. marina's unique photosynthetic machinery, this protein is particularly significant as it operates within a photosystem that predominantly utilizes chlorophyll d rather than chlorophyll a, allowing this cyanobacterium to harvest far-red light for photosynthesis . The D1 protein forms part of the heterodimeric reaction center core along with the D2 protein, creating the structural and functional foundation for photosynthetic electron transport. Recent cryo-electron microscopic studies have revealed that this protein is integrated into a massive 1.9 megadalton PSII-Pcb tetrameric megacomplex, where it participates in the coordinated light harvesting and energy transfer processes essential for A. marina's adaptation to marine environments with low visible light intensity but high near-infrared radiation .

How does Photosystem Q(B) protein 2 in A. marina differ from its counterparts in other cyanobacteria?

The Photosystem Q(B) protein 2 (D1) in A. marina exhibits several distinctive features that differentiate it from homologous proteins in other cyanobacteria, particularly related to its adaptation to far-red light photosynthesis . A significant difference lies in its interaction with chlorophyll d rather than chlorophyll a, which represents an evolutionary adaptation that shifts the absorption spectrum toward longer wavelengths . Structural analysis reveals that despite these functional differences, the core architecture of the reaction center is remarkably conserved, with the relative distances between cofactors in the PSII reaction center showing high similarity among A. marina, Thermosynechococcus vulcanus, and Synechocystis 6803 . The protein appears in a unique supramolecular organization within A. marina, where it participates in a massive PSII-Pcb tetrameric megacomplex consisting of two PSII core dimers flanked by sixteen symmetrically related Pcb proteins . Another notable distinction involves the interaction with extrinsic proteins; the PsbO subunit appears to bind less stably in A. marina, potentially due to structural variations in its binding interface . Finally, while most cyanobacteria rely on PsbA variants optimized for visible light, A. marina's psbA2-encoded D1 protein has evolved to function efficiently with the predominantly chlorophyll d-based electron transfer chain, enabling this organism to occupy ecological niches with abundant far-red light .

What is the amino acid sequence and structural features of A. marina Photosystem Q(B) protein 2?

The amino acid sequence of A. marina Photosystem Q(B) protein 2 (D1) consists of 360 amino acids (1-360) and has been identified as: "MTTVLQRRESASAWERFCSFITSTNNRLYIGWFGVLMIPTLLTAVTCFVIAFIGAPPVDIDGIREPVAGSLLYGNNIITGAVVPSSNAIGLHLYPIWEAASLDEWLYNGGPYQLIIFHYMIGCICYLGRQWEYSYRLGMRPWICVAYSAPLAATYSVFLIYPLGQGSFSDGMPLGISGTFNFMFVFQAEHNILMHPFHMFGVAGVLGGSLFAAMHGSLVSSTLVRETTEGESANYGYKFGQEEETYNIVAAHGYFGRLIFQYASFSNSRSLHFFLGAWPVVCIWLTAMGISTMAFNLNGFNFNHSIVDSQGNVVNTWADVLNRANLGFEVMHERNAHNFPLDLAAGESAPVALTAPVING" . This protein features several key structural elements that enable its function within the photosynthetic reaction center, including transmembrane helices that anchor it within the thylakoid membrane and specific binding sites for cofactors involved in electron transport . High-resolution structural studies have revealed that critical residues such as His198 coordinate the special pair chlorophylls (P_D1) at the interface with D2 . Notable functional motifs include three residues (Asp170, Glu333, and Asp342) that serve as ligands for the Mn₄CaO₅ cluster, which are completely conserved in psbA2 and other species but differ in the psbA1 gene (changed to Glu170, Ser333, and Thr342), confirming the assignment of psbA2 in the functional photosystem . The protein's structure accommodates chlorophyll d molecules in various binding positions including P_D1/P_D2, Chl_D1/Chl_D2, and Chl_ZD1/Chl_ZD2, although some positions may potentially bind chlorophyll a instead .

What expression systems and conditions are optimal for producing recombinant A. marina Photosystem Q(B) protein 2?

Recombinant production of A. marina Photosystem Q(B) protein 2 has been successfully accomplished using Escherichia coli as the expression host, as demonstrated in commercial and research preparations . The optimal expression system utilizes E. coli strains specifically designed for membrane protein expression, equipped with rare codon supplementation to accommodate the cyanobacterial codon usage bias. Expression vectors incorporating an N-terminal histidine tag facilitate subsequent purification while maintaining the protein's structural integrity . Temperature modulation during induction is critical, with lower temperatures (16-20°C) generally yielding higher amounts of properly folded protein compared to standard induction temperatures. The addition of specific chaperones and careful optimization of inducer concentration can significantly improve the yield of functional protein. Cultivation under microaerobic conditions has been shown to enhance membrane protein integration and reduce the formation of inclusion bodies. For studies requiring functional characterization, co-expression with other photosystem II components may be necessary to facilitate proper folding and assembly. Post-expression processing typically involves membrane fraction isolation followed by detergent solubilization, with mild detergents such as n-dodecyl-β-D-maltoside (DDM) or digitonin being preferred to maintain the native-like environment for this integral membrane protein .

What purification strategies yield the highest purity and functional integrity for A. marina Photosystem Q(B) protein 2?

Purification of A. marina Photosystem Q(B) protein 2 requires a multi-step approach that balances high purity with preservation of functional integrity . The initial purification typically employs immobilized metal affinity chromatography (IMAC) leveraging the recombinant His-tag, with careful optimization of imidazole concentration gradients to minimize non-specific binding while maximizing target protein recovery . Following IMAC, size exclusion chromatography (SEC) serves as a critical polishing step to separate monomeric protein from aggregates and to exchange the protein into a stabilizing buffer system. Throughout the purification process, the detergent environment must be meticulously maintained at concentrations above the critical micelle concentration to prevent protein aggregation or denaturation. Ion exchange chromatography may be incorporated as an intermediate step when higher purity is required, particularly to remove contaminating E. coli proteins with similar molecular weights. For functional studies, it is essential to maintain a consistent temperature (typically 4°C) throughout the purification process and to include glycerol (5-20%) in all buffers to enhance protein stability. The final purified product should achieve greater than 90% purity as assessed by SDS-PAGE, with verification of proper folding through circular dichroism or limited proteolysis . To preserve cofactor binding capabilities, purification buffers are often supplemented with cofactors or stabilizing agents that mimic the native environment of the thylakoid membrane.

How should researchers reconstitute and store recombinant A. marina Photosystem Q(B) protein 2 to maintain optimal activity?

Proper reconstitution and storage of recombinant A. marina Photosystem Q(B) protein 2 is critical for maintaining its structural integrity and functional activity in experimental settings . The lyophilized protein should be briefly centrifuged prior to opening the vial to ensure all material is collected at the bottom. Reconstitution should be performed in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with gentle mixing rather than vigorous vortexing to prevent protein denaturation . For long-term storage, it is strongly recommended to add glycerol to a final concentration of 5-50% (with 50% being the default recommendation) and to divide the solution into small aliquots before storing at -20°C or preferably -80°C . This approach minimizes protein degradation from repeated freeze-thaw cycles, which are particularly detrimental to membrane proteins. For working solutions, aliquots can be maintained at 4°C for up to one week, but longer periods at this temperature may lead to significant activity loss . If the protein is to be used in functional assays, reconstitution into liposomes or nanodiscs may be necessary to provide a membrane-like environment that supports native conformation and activity. The reconstitution buffer should be carefully selected, with Tris/PBS-based buffer at pH 8.0 containing 6% trehalose being identified as particularly effective for maintaining protein stability during freeze-thaw cycles . Researchers should verify protein quality after storage by analytical techniques such as dynamic light scattering or size exclusion chromatography to ensure monodispersity.

How does the redox potential of QB binding site in A. marina compare to other photosynthetic organisms, and what are the functional implications?

The redox potential of the QB binding site in A. marina's photosystem II represents a critical bioenergetic parameter that influences the organism's unique photosynthetic capabilities . Research using fluorescence-based redox titration has established that the midpoint redox potential (Em) of the QA/QA- couple in A. marina is approximately +64 mV, which shifts to +89 mV in the presence of the herbicide DCMU (3-(3,4-dichlorophenyl)-1,1-dimethylurea) . This value differs significantly from those found in conventional chlorophyll a-containing cyanobacteria, reflecting adaptations that enable A. marina to perform photosynthesis using far-red light. The altered redox potential likely compensates for the lower excitation energy available from chlorophyll d compared to chlorophyll a, ensuring efficient electron flow through the photosynthetic electron transport chain. While the search results do not provide direct measurements of the QB potential specifically, the redox properties of QA influence the subsequent electron transfer to QB, as these quinones function sequentially in the photosynthetic electron transport chain. The unique redox characteristics of A. marina's electron transport components represent evolutionary adaptations that enable this organism to occupy ecological niches with abundant far-red light but limited visible light, demonstrating nature's remarkable capacity for photosynthetic specialization . Understanding these redox properties provides valuable insights for bioengineering applications aimed at expanding the spectral range of photosynthesis in other organisms.

What is known about the interaction between chlorophyll d and Photosystem Q(B) protein 2 in A. marina?

The interaction between chlorophyll d and Photosystem Q(B) protein 2 (D1) in A. marina represents a unique adaptation that enables photosynthesis using far-red light wavelengths beyond the range utilized by most photosynthetic organisms . Structural studies have revealed that the D1 protein coordinates several chlorophyll d molecules, including those in the special pair (PD1/PD2) at the interface with D2, which are coordinated by His198 of D1 and His196 of D2, respectively . This arrangement is critical for the primary charge separation events that initiate photosynthetic electron transport. The substitution of chlorophyll a with chlorophyll d in these positions shifts the absorption maximum towards longer wavelengths (approximately 30 nm red-shifted), allowing A. marina to harvest photons in the far-red region of the spectrum (700-750 nm) . Despite this pigment substitution, the relative distances between cofactors in the PSII reaction center remain highly conserved compared to chlorophyll a-containing species, suggesting that the fundamental electron transfer mechanisms have been preserved while adapting to different light conditions . Research indicates that some positions within the photosystem may still retain chlorophyll a, creating a mixed pigment environment that optimizes energy transfer and electron transport under the unique light conditions where A. marina thrives . The interaction between D1 and chlorophyll d enables this cyanobacterium to occupy ecological niches with low visible light but abundant far-red radiation, demonstrating a remarkable evolutionary adaptation of the photosynthetic apparatus .

How do mutations in the psbA2 gene affect the function and assembly of Photosystem Q(B) protein 2 in A. marina?

Mutations in the psbA2 gene, which encodes Photosystem Q(B) protein 2 (D1) in A. marina, can profoundly impact both the function and assembly of this critical photosynthetic component, though research in this specific area remains limited compared to model organisms . The psbA2 gene contains several highly conserved residues that are essential for D1 function, including Asp170, Glu333, and Asp342 which serve as ligands for the Mn₄CaO₅ cluster of the oxygen-evolving complex . Mutations at these positions would likely compromise water oxidation capability, disrupting the entire photosynthetic electron transport chain. The gene sequence also encodes specific histidine residues, such as His198, which coordinate chlorophyll molecules in the reaction center; alterations to these amino acids would disrupt pigment binding and potentially destabilize the entire PSII core structure . Beyond these functional impacts, mutations in psbA2 could interfere with the assembly of the massive 1.9 MDa PSII-Pcb megacomplex by disrupting protein-protein interactions between D1 and other PSII subunits or the associated Pcb antenna proteins . A. marina possesses an alternative "rogue D1" variant encoded by psbA1, which contains several altered residues including substitutions at positions involved in manganese cluster coordination; this gene appears to be inactive under standard culture conditions, suggesting it may serve specialized roles under specific environmental stresses . The existence of this paralog provides intriguing possibilities for investigating differential expression and function of D1 variants in response to varying light conditions or other environmental parameters.

What is the evolutionary significance of A. marina's unique Photosystem Q(B) protein 2 in relation to photosynthetic adaptation?

The evolutionary development of A. marina's unique Photosystem Q(B) protein 2 (D1) represents a remarkable example of photosynthetic adaptation that has enabled this cyanobacterium to exploit ecological niches inaccessible to most photosynthetic organisms . By evolving to incorporate chlorophyll d as its predominant photosynthetic pigment, A. marina has extended the spectral range of oxygenic photosynthesis into the far-red region (700-750 nm), allowing it to thrive in marine environments with low visible light intensity but abundant near-infrared radiation . The psbA2-encoded D1 protein has adapted to interact effectively with chlorophyll d while maintaining the fundamental electron transfer mechanisms conserved across oxygenic photosynthetic organisms, as evidenced by the preservation of key distances between cofactors in the reaction center . This evolutionary innovation represents a significant departure from the chlorophyll a-dominated photosynthesis that has prevailed for billions of years, demonstrating the remarkable plasticity of the photosynthetic apparatus. The presence of an inactive psbA1 gene encoding a "rogue D1" variant suggests ongoing evolutionary processes, potentially providing adaptive flexibility under changing environmental conditions . The integration of D1 into a massive PSII-Pcb tetrameric megacomplex (1.9 MDa) with sixteen associated Pcb antenna proteins indicates co-evolution of the core reaction center with its light-harvesting system to optimize energy capture and transfer under far-red light conditions . Understanding these adaptations has significant implications for both evolutionary biology and applied research, potentially informing bioengineering efforts to extend the spectral range of crop plants or to develop bio-inspired solar energy conversion systems that utilize a broader spectrum of solar radiation .

What are common challenges when working with recombinant A. marina Photosystem Q(B) protein 2 and how can they be overcome?

Researchers working with recombinant A. marina Photosystem Q(B) protein 2 encounter several significant challenges that require careful methodological considerations . Protein solubility and stability represent primary concerns, as this integral membrane protein tends to aggregate when removed from its native lipid environment. This challenge can be addressed by maintaining appropriate detergent concentrations throughout purification and storage, with n-dodecyl-β-D-maltoside (DDM) or digitonin often proving effective for preserving protein structure . Low expression yields in heterologous systems present another common obstacle, which can be mitigated by optimizing codon usage for the expression host, lowering induction temperature to 16-20°C, and co-expressing molecular chaperones to assist proper folding. Maintaining cofactor association during purification poses another difficulty; supplementing buffers with appropriate pigments or reconstituting the protein into liposomes containing physiological lipid compositions can help preserve functional integrity. The assessment of functional activity presents particular challenges since the protein normally functions within a complex multiprotein assembly. This issue can be addressed by developing simplified electron transfer assays using artificial electron acceptors or partial reconstitution with minimal components necessary for specific functions. Finally, the protein's sensitivity to freeze-thaw cycles necessitates careful storage practices, including the addition of cryoprotectants such as glycerol (5-50%) and trehalose (6%), aliquoting into single-use volumes, and maintaining consistent storage temperatures (preferably -80°C) . When troubleshooting purification problems, size-exclusion chromatography profiles provide valuable diagnostic information, with monodisperse peaks indicating properly folded protein while the presence of void volume material suggests aggregation requiring buffer optimization.

How can researchers effectively distinguish between chlorophyll a and chlorophyll d in studies of A. marina photosystems?

Distinguishing between chlorophyll a and chlorophyll d in studies of A. marina photosystems requires specialized analytical approaches that exploit the distinct spectral and chemical properties of these pigments . High-performance liquid chromatography (HPLC) coupled with photodiode array detection represents one of the most effective methods, capable of separating these pigments based on their differing polarities and providing characteristic absorption profiles for identification. Chlorophyll d exhibits a distinctive red-shifted absorption maximum (approximately 696 nm in organic solvents) compared to chlorophyll a (approximately 665 nm), allowing spectroscopic differentiation even in complex pigment mixtures. For in-depth analysis, HPLC coupled with mass spectrometry (LC-MS) provides definitive identification based on the unique molecular weights of chlorophyll a (893.5 Da) and chlorophyll d (895.5 Da), as well as characteristic fragmentation patterns that reflect their structural differences. When studying intact protein complexes, circular dichroism spectroscopy can reveal distinctions in exciton coupling between protein-bound chlorophylls, while resonance Raman spectroscopy provides vibrational fingerprints sensitive to the specific chemical environments of each chlorophyll type. For research questions focused on spatial distribution, confocal fluorescence microscopy with appropriate wavelength filters can localize different chlorophyll species within cellular structures based on their distinct emission properties. New methodological approaches combining high-resolution structural data from cryo-EM with mass spectrometry-based proteomics and targeted pigment analysis have revolutionized our ability to map specific chlorophyll types to their binding sites within the PSII-Pcb megacomplex, revealing that while chlorophyll d predominates, certain specialized positions may retain chlorophyll a for specific functional reasons .

What controls and validation methods are essential when studying electron transfer in A. marina's photosystem II?

Rigorous experimental controls and validation methods are essential when investigating electron transfer processes in A. marina's photosystem II to ensure reliable and interpretable results . Primary among these is the preparation of well-characterized protein samples with verified purity (>90% by SDS-PAGE) and structural integrity, confirmed through techniques such as circular dichroism or limited proteolysis . Redox potential measurements require careful calibration with standard redox couples of known midpoint potentials, while maintaining precise control of experimental parameters including pH, temperature, and ionic strength that can significantly influence electron transfer kinetics . When studying the QA/QA- redox couple specifically, researchers should employ low-intensity measuring flashes (~0.01 μE m⁻² s⁻¹) to prevent photochemical reduction of QA during measurements, as demonstrated in previous studies yielding an Em value of +64 mV for A. marina . The addition of specific electron transport inhibitors, such as DCMU (which shifts the Em to +89 mV), serves as an important control to verify the identity of the measured redox couple and provides complementary information about the QB binding site . Comparative studies with other cyanobacterial species processed under identical conditions provide essential reference points for interpreting A. marina's unique electron transfer properties. Oxygen evolution measurements correlated with electron transfer kinetics help validate that observed electron transfer events contribute to productive photosynthesis rather than non-productive side reactions. Additionally, measurements under varying light qualities (particularly comparing visible versus far-red illumination) provide critical insights into the functional adaptations of A. marina's photosynthetic apparatus to its unique spectral environment . Finally, mathematical modeling of electron transfer kinetics should incorporate sensitivity analyses to identify parameters most critical for accurate representation of the experimental system.

What are promising research avenues for understanding the role of Photosystem Q(B) protein 2 in far-red light adaptation?

Several promising research directions could significantly advance our understanding of how Photosystem Q(B) protein 2 (D1) contributes to A. marina's remarkable adaptation to far-red light photosynthesis . Comparative genomics and directed evolution approaches could identify the specific amino acid substitutions that enable D1 to function optimally with chlorophyll d rather than chlorophyll a, providing insights into the molecular basis of spectral adaptation. High-time-resolution spectroscopic studies tracking electron transfer from primary photochemistry through the quinone acceptors would reveal how the energetics of these processes have adapted to the lower excitation energy available from far-red light, potentially uncovering novel mechanisms for maintaining efficient charge separation despite thermodynamic constraints. Investigation of the inactive psbA1 gene under various stress conditions might reveal specialized roles for this "rogue D1" variant and shed light on regulatory mechanisms that control D1 isoform expression in response to environmental changes . Cryogenic electron paramagnetic resonance (EPR) spectroscopy could provide valuable insights into the electronic structure of redox-active cofactors within the D1 protein environment, potentially revealing adaptations in metal-ligand interactions that optimize electron transfer under far-red light conditions. Structure-guided mutagenesis targeting specific chlorophyll-binding sites would help determine the functional significance of mixed chlorophyll a/d binding and identify critical positions where one pigment cannot substitute for the other. Single-molecule studies examining the conformational dynamics of the D1 protein during the photosynthetic water oxidation cycle could reveal adaptations in protein flexibility or proton-coupled electron transfer pathways. Finally, bioengineering approaches attempting to introduce A. marina's D1 adaptations into crop plants could potentially expand their photosynthetic spectral range, with significant implications for agricultural productivity under canopy or shade conditions .

How might structures of A. marina photosystem components inform the development of bio-inspired solar technologies?

The unique structural and functional characteristics of A. marina's photosystem components, particularly the D1 protein and its integration within the PSII-Pcb megacomplex, offer valuable inspiration for next-generation solar technologies designed to harvest a broader spectrum of solar radiation . The recently resolved 3.6 Å cryo-EM structure of the PSII-Pcb megacomplex reveals design principles for efficient energy transfer networks that could inform the development of biomimetic light-harvesting arrays incorporating far-red-absorbing chromophores . The precise arrangement of chlorophyll d molecules within the protein scaffold provides a blueprint for designing artificial reaction centers capable of generating charge separation using lower-energy photons than conventional photovoltaic systems. The tetrameric arrangement of the megacomplex, with its symmetrical distribution of antenna proteins around the reaction centers, suggests architectural principles for optimizing spatial organization in artificial photosynthetic systems to maximize both light capture and energy transfer efficiency. Understanding how the D1 protein has adapted to coordinate chlorophyll d while maintaining efficient electron transfer could guide the development of hybrid biological-artificial systems incorporating novel pigments with tailored spectral properties. The robust structural framework of the megacomplex, which enables efficient function in challenging marine environments, provides insights for designing stable artificial photosystems capable of operating under variable conditions. Bio-inspired solar cells incorporating elements from A. marina's photosystem architecture could potentially harvest photons in the 700-750 nm range that lie beyond the effective range of both conventional silicon photovoltaics and most natural photosynthetic systems, significantly increasing the utilization of the solar spectrum . Finally, understanding the molecular mechanisms of photoprotection in A. marina's photosystems could inform strategies for enhancing the operational lifetime and stress resistance of artificial photosynthetic devices.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.