Recombinant Acaryochloris marina Protein translocase subunit SecF (secF)

Shipped with Ice Packs
In Stock

Description

Molecular Identity of Recombinant Acaryochloris marina SecF

Recombinant A. marina SecF (UniProt ID: B0CEA6) is a transmembrane protein produced in E. coli expression systems. Key specifications include:

ParameterDetails
Expression SystemE. coli
TagN-terminal 10xHis tag
Sequence Length319 amino acids (full-length)
SequenceMKLNLNQQRGLWWTISAALILAGVISMALSWNQYQAPLKPGLDFTGGTRLQLERDCSKPDNCKTPIQIAEVRQILDEQKLAESNVQVIGQNAQGVAIRTKDLNQEERTKLTEALTAKLGQLDVEKSQIDTVGPTLGKQLLASGLLALIVSFAAIIVYVSVRFQFDYALFAIVALFHDVLVTMGFFSILGLTRGVEVNSLFIVGLLTIIGFSVNDTVVIYDRVRENLKYGAKRSISETVDIAVNQTLGRSINTSLTTGLPLIGIYIFGGETLKDFALTLIVGFAAGAYSSIFIASTLLAWW RQRQERGGYNTMDSSPEEI
Storage-20°C/-80°C (lyophilized); working aliquots at 4°C (≤1 week)
Purity>90% (SDS-PAGE)

Biological Role in the Sec Translocase System

SecF operates in conjunction with SecD as part of the SecDF complex, which enhances late-stage protein translocation by leveraging proton motive force (PMF) to pull polypeptides through the SecYEG channel . Key functional insights:

  • Structural Interaction: SecF’s periplasmic domains interact dynamically with SecYEG, facilitating conformational changes that drive substrate release .

  • Genetic Context: In A. marina, secF is encoded on the main chromosome alongside other Sec components, reflecting evolutionary conservation of the translocase system .

Expression and Purification

  • Host System: Optimized for E. coli with codon adaptation to enhance soluble expression .

  • Reconstitution: Requires Tris/PBS-based buffer with 6% trehalose (pH 8.0) for stability; glycerol (5–50%) is recommended for long-term storage .

Research Applications

  • Mechanistic Studies: Used to investigate PMF-driven translocation dynamics in chlorophyll d-adapted cyanobacteria .

  • Protein-Protein Interaction Assays: Facilitates structural analysis of SecDF-YEG holocomplex assembly .

Comparative Insights from Prokaryotic Homologs

While A. marina SecF shares homology with Prochlorococcus marinus SecF (UniProt Q7VCH2), its unique sequence adaptations likely reflect niche-specific requirements:

FeatureA. marina SecFP. marinus SecF
Length319 residues321 residues
Expression TagN-terminal His tagN-terminal His tag
Critical DomainsConserved TMS helicesSimilar helical architecture

Challenges and Future Directions

  • Functional Redundancy: SecF’s role overlaps with SecD, complicating in vitro disentanglement of individual contributions .

  • Ecological Adaptation: Links between SecF and A. marina’s chlorophyll d-based photobiology remain unexplored .

References

  1. Creative Biomart: Prochlorococcus marinus SecF

  2. PMC: Bacterial Sec-translocase mechanism

  3. Cusabio: Acaryochloris marina SecF

  4. PubMed: A. marina genome

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery estimates.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please notify us in advance, as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot the protein for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
secF; AM1_0694; Protein translocase subunit SecF
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-319
Protein Length
full length protein
Species
Acaryochloris marina (strain MBIC 11017)
Target Names
secF
Target Protein Sequence
MKLNLNQQRGLWWTISAALILAGVISMALSWNQYQAPLKPGLDFTGGTRLQLERDCSKPD NCKTPIQIAEVRQILDEQKLAESNVQVIGQNAQGVAIRTKDLNQEERTKLTEALTAKLGQ LDVEKSQIDTVGPTLGKQLLASGLLALIVSFAAIIVYVSVRFQFDYALFAIVALFHDVLV TMGFFSILGLTRGVEVNSLFIVGLLTIIGFSVNDTVVIYDRVRENLKYGAKRSISETVDI AVNQTLGRSINTSLTTGLPLIGIYIFGGETLKDFALTLIVGFAAGAYSSIFIASTLLAWW RQRQERGGYNTMDSSPEEI
Uniprot No.

Target Background

Function
SecF is a component of the Sec protein translocase complex. It interacts with the SecYEG preprotein conducting channel. SecDF utilizes the proton motive force (PMF) to complete protein translocation following the ATP-dependent function of SecA. It likely participates in protein translocation into and across both the cytoplasmic and thylakoid membranes in cyanobacterial cells.
Database Links
Protein Families
SecD/SecF family, SecF subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Protein translocase subunit SecF in Acaryochloris marina and what is its primary function?

Protein translocase subunit SecF in Acaryochloris marina (strain MBIC 11017) is a membrane protein that participates in protein translocation across both cytoplasmic and thylakoid membranes in cyanobacterial cells . As part of the Sec translocation pathway, SecF works in conjunction with other translocation machinery components to facilitate the movement of proteins across membranes. The protein belongs to the SecD/SecF family, specifically the SecF subfamily, and plays a crucial role in the post-translocation steps of protein secretion .

The functional importance of SecF must be considered within the context of A. marina's unique photosynthetic adaptations. As this cyanobacterium has evolved to use chlorophyll d as its primary photosynthetic pigment for capturing far-red light, the protein translocation systems likely play specialized roles in assembling and maintaining the modified photosynthetic apparatus .

How does A. marina SecF compare to homologs in other cyanobacteria?

While the search results don't provide direct comparative analysis of SecF across different cyanobacteria, we can infer that A. marina's SecF likely has unique features corresponding to its specialized environmental adaptations. A. marina possesses one of the largest bacterial genomes sequenced (8.3 million base pairs), with significant gene duplication and horizontal gene transfer contributing to its genetic diversity .

The protein translocation machinery in A. marina may have evolved specific features to accommodate the organism's unique photosynthetic apparatus. For comparative analysis, researchers should consider:

  • Sequence alignment with SecF proteins from other cyanobacteria to identify conserved and divergent regions

  • Phylogenetic analysis to determine evolutionary relationships

  • Structural modeling to predict functional differences

  • Experimental validation through complementation studies in heterologous systems

What expression systems are optimal for producing recombinant A. marina SecF protein?

Based on available information about membrane protein expression and the specific properties of SecF, researchers should consider the following expression systems:

E. coli-based expression systems:

  • BL21(DE3) strains with modifications for membrane protein expression (C41, C43)

  • Codon-optimized constructs to account for different codon usage between A. marina and E. coli

  • Use of fusion tags (His6, MBP, SUMO) to improve solubility and facilitate purification

  • Temperature-controlled expression (typically 16-25°C) to allow proper membrane insertion

Alternative expression hosts:

  • Yeast systems (Pichia pastoris or Saccharomyces cerevisiae) for eukaryotic membrane protein folding machinery

  • Cell-free expression systems for direct incorporation into liposomes or nanodiscs

  • Homologous expression in other cyanobacteria if A. marina transformation is challenging

The expression construct should include appropriate fusion tags and protease cleavage sites to enable purification while maintaining protein function. Expression trials should evaluate protein yield, localization, and functional integrity to determine the optimal system.

What purification strategies are most effective for isolating recombinant SecF?

Purification of SecF, as a membrane protein, requires specialized approaches:

Purification StepMethodKey Considerations
Membrane IsolationDifferential centrifugationCell disruption should be gentle to preserve membrane integrity
SolubilizationDetergent extractionTest multiple detergents (DDM, LMNG, Digitonin) for optimal solubilization
Affinity PurificationIMAC (for His-tagged constructs)Use detergent in all buffers; consider gradient elution
Secondary PurificationSize exclusion chromatographyAssess oligomeric state and detergent micelle contribution
Quality ControlSDS-PAGE, Western blot, Mass spectrometryVerify purity, identity, and integrity

For functional studies, consider reconstituting the purified protein into proteoliposomes or nanodiscs to provide a membrane-like environment. The choice of lipid composition should reflect the native membrane environment of A. marina when possible.

What storage conditions maintain stability of purified recombinant SecF protein?

To maintain the stability and activity of purified SecF protein:

  • Store in Tris-based buffer with 50% glycerol at -20°C for short-term storage or -80°C for extended storage

  • Avoid repeated freeze-thaw cycles which can denature membrane proteins

  • For working stocks, store aliquots at 4°C for up to one week

  • Include appropriate detergent at concentrations above critical micelle concentration (CMC)

  • Consider adding reducing agents (DTT, TCEP) and protease inhibitors

  • For long-term stability, reconstitution into lipid environments may be preferable to detergent solutions

What experimental assays can measure SecF translocation activity?

Several methodological approaches can be employed to assess the functional activity of SecF:

In vitro translocation assays:

  • Reconstituted proteoliposome systems containing purified SecF and other Sec components

  • Fluorescently labeled substrate proteins to track translocation efficiency

  • Site-specific crosslinking to capture translocation intermediates

  • ATP hydrolysis assays to measure energetics of the translocation process

In vivo functional complementation:

  • Heterologous expression in SecF-depleted strains to assess functional conservation

  • Creation of conditional mutants to study SecF essentiality

  • Fluorescent reporter fusions to visualize protein secretion in real-time

Interaction studies:

  • Co-immunoprecipitation with other Sec pathway components

  • Bacterial two-hybrid analysis of protein-protein interactions

  • Native PAGE electrophoresis to identify stable complexes

  • Surface plasmon resonance to measure binding kinetics

The selection of appropriate assays should be guided by the specific research question and available resources.

How can researchers investigate SecF's role in thylakoid membrane biogenesis?

To study SecF's specific contribution to thylakoid membrane formation in A. marina:

  • Genetic approaches:

    • Generate conditional knockdown strains using inducible antisense RNA

    • CRISPR interference (CRISPRi) for targeted gene repression

    • Site-directed mutagenesis of conserved residues to create separation-of-function mutants

  • Microscopy techniques:

    • Electron microscopy to visualize thylakoid membrane architecture

    • Fluorescence microscopy with tagged thylakoid proteins to track localization

    • Super-resolution microscopy to map SecF distribution relative to thylakoid membranes

  • Proteomics methods:

    • Comparative proteomics of thylakoid membranes under SecF-depleted conditions

    • Pulse-chase experiments to track protein integration into thylakoids

    • Quantitative analysis of thylakoid protein composition

  • Biophysical characterization:

    • Atomic force microscopy of isolated thylakoid membranes

    • Spectroscopic analysis of photosynthetic complexes to assess correct assembly

These methodologies would help elucidate how SecF contributes to the biogenesis of thylakoid membranes, particularly in the context of A. marina's unique photosynthetic apparatus.

How might SecF function relate to A. marina's adaptation to far-red light environments?

A. marina has uniquely adapted to far-red light-enriched environments using red-shifted chlorophyll d . This adaptation involves specialized photosynthetic machinery that must be correctly assembled and maintained in the thylakoid membranes.

SecF likely plays a critical role in this adaptation through:

  • Facilitating the translocation of specialized proteins involved in chlorophyll d biosynthesis

  • Contributing to the assembly of modified photosystems optimized for far-red light harvesting

  • Maintaining the integrity of thylakoid membranes with unique protein and pigment compositions

  • Potentially participating in adaptive stress responses to changing light conditions

Research approaches to investigate this relationship could include:

  • Comparative analysis of SecF function under different light conditions

  • Identification of SecF-dependent substrates specific to far-red light adaptation

  • Analysis of thylakoid membrane composition in SecF-depleted cells grown under far-red light

  • Investigation of potential regulatory mechanisms that might modulate SecF activity in response to light quality

The connection between protein translocation machinery and photosynthetic adaptations represents an exciting frontier in understanding how cyanobacteria like A. marina have evolved to occupy specialized ecological niches.

What challenges exist in studying SecF function in the context of A. marina's unusual genome?

A. marina possesses an exceptionally large genome (8.3 million base pairs) with multiple plasmids accounting for >25% of the putative ORFs . This genomic complexity presents several challenges for SecF research:

  • Genetic redundancy: Potential paralogs or functionally overlapping genes may mask phenotypes in single-gene studies

  • Transformation difficulties: The large genome and potential restriction barriers may complicate genetic manipulation

  • Regulatory complexity: Extensive gene duplication and horizontal gene transfer may have created complex regulatory networks

  • Plasmid distribution: The distribution of genes across nine single-copy plasmids requires consideration of potential plasmid loss during laboratory cultivation

Methodological approaches to address these challenges include:

  • Whole-genome analysis to identify all potential Sec pathway components

  • Comparison with model cyanobacteria to identify conserved and A. marina-specific features

  • Development of genetic tools specifically optimized for A. marina

  • Systems biology approaches to map gene regulatory networks affecting protein translocation

What are the implications of studying SecF for understanding protein translocation in photosynthetic membranes?

Research on A. marina SecF has broader implications for understanding protein translocation in specialized membrane systems:

  • Evolutionary insights: Comparing SecF across diverse photosynthetic organisms can reveal how protein translocation systems have co-evolved with photosynthetic innovations

  • Bioenergetic considerations: Understanding how protein translocation is energetically coupled to photosynthesis could reveal new principles of cellular energetics

  • Biotechnological applications: Knowledge of efficient translocation mechanisms could inform the design of synthetic biological systems for producing membrane proteins

  • Environmental adaptation mechanisms: SecF studies may reveal how membrane protein homeostasis contributes to environmental adaptation in photosynthetic organisms

The study of SecF in A. marina provides a unique window into the specialized protein translocation requirements of a cyanobacterium that has evolved significant adaptations to its light environment. Such research may reveal fundamental principles about the co-evolution of cellular systems during niche adaptation.

What controls should be included when working with recombinant A. marina SecF?

Rigorous experimental design for SecF studies should include:

Positive controls:

  • Well-characterized SecF homologs from model organisms

  • Known substrates of the Sec pathway in cyanobacteria

  • Functional assays with validated readouts

Negative controls:

  • Inactive SecF mutants (e.g., mutations in conserved residues)

  • Unrelated membrane proteins of similar size/structure

  • Non-Sec pathway substrates

Validation approaches:

  • Multiple detection methods for protein expression and localization

  • Complementary assays for functional activity

  • Replication across different expression constructs and conditions

How can researchers differentiate between direct and indirect effects when studying SecF function?

To distinguish direct effects of SecF function from secondary consequences:

  • Time-resolved studies: Track immediate versus delayed responses following SecF depletion or inhibition

  • Substrate specificity analysis: Identify which proteins show translocation defects versus general effects

  • Structure-function studies: Create separation-of-function mutants that affect specific aspects of SecF activity

  • In vitro reconstitution: Isolate the system to directly observe SecF-dependent processes

  • Chemical genetics: Use small molecule inhibitors with rapid onset of action to minimize adaptive responses

These approaches help establish causality and distinguish primary functions from downstream effects in complex cellular systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.