Recombinant Acaryochloris marina Proton extrusion protein PcxA (pcxA)

Shipped with Ice Packs
In Stock

Description

Functional Role in Proton Extrusion

PcxA facilitates proton transport across the thylakoid membrane, contributing to the proton gradient essential for ATP synthesis during photosynthesis. Key functional insights:

  • Mechanism: Acts as a proton pump, likely coupled with photosynthetic electron transport chains .

  • Localization: Integrated into thylakoid membranes, where it interacts with photosystem II (PSII) complexes .

  • Biochemical Activity: Demonstrates ATP-binding capability, suggesting energy-dependent proton translocation .

Comparative Functional Annotations (from homologs):

FunctionRelated ProteinsSource Organism
Proton extrusionPcxA, PCXBA. marina, Synechocystis
ATP bindingPCXB, ACACA, ACACBCyanobacteria
Membrane integrationCBPII, IsiAA. marina

3.1. Photosynthesis Studies

  • Far-Right Light Adaptation: A. marina’s unique chlorophyll d-based photosynthesis relies on proton gradients maintained by proteins like PcxA. Studies show that PcxA expression correlates with enhanced PSII activity under low-oxygen conditions .

  • Antenna Complex Interactions: Recombinant PcxA has been used to study competitive interactions between phycobiliproteins and chlorophyll-binding proteins in hybrid systems (e.g., Synechocystis PCC6803) .

3.2. Biotechnological Relevance

  • ELISA and Protein Assays: Commercial recombinant PcxA is utilized in enzyme-linked immunosorbent assays (ELISAs) to quantify protein interactions and membrane dynamics .

  • Stress Response Modeling: PcxA expression profiles under hyperoxic/microoxic conditions provide insights into cyanobacterial stress adaptation .

Pathway Involvement

PcxA participates in metabolic and photosynthetic pathways:

PathwayRoleKey Partners
Photosynthetic electron transportMaintains proton motive force for ATP synthasePSII, cytochrome b₆f
Oxidative stress responseRegulates intracellular pH under hyperoxiaSuperoxide dismutases

Future Directions

  • Structural Resolution: Cryo-EM studies are needed to map PcxA’s transmembrane topology.

  • Metabolic Engineering: Exploiting PcxA in synthetic biology for bioenergy applications (e.g., hydrogen production) .

Recombinant PcxA remains a pivotal tool for deciphering far-red photosynthesis mechanisms and advancing bioenergy research. Its dual role in proton transport and stress adaptation underscores its ecological and biotechnological significance.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your request whenever possible.
Lead Time
Delivery times may vary depending on the purchasing method and location. For specific delivery details, please consult your local distributors.
Note: Our proteins are shipped with standard blue ice packs by default. If dry ice shipment is required, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is discouraged. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference for your use.
Shelf Life
The shelf life of our products is influenced by various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store the protein at -20°C/-80°C. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
The specific tag type will be determined during the manufacturing process.
If you have a specific tag type preference, please inform us. We will prioritize developing the specified tag if feasible.
Synonyms
pcxA; AM1_4479; Proton extrusion protein PcxA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-482
Protein Length
full length protein
Species
Acaryochloris marina (strain MBIC 11017)
Target Names
pcxA
Target Protein Sequence
MSSSSPNPFRRSLKFVEQWYRETPQRALDGAYEAARAIEEIEKKHFKGQPVPLRIRTESV MTNYFQSEVQKNLQFIQTRLREFKSSSLVVEVADKLKPPSIPPAPTPLDTPNTIDFTDEY DVTSEEYSSELVSPSIDAQGSLDKLAFIDAVLKRYRSASIQREAAAAASKAARASAPKSG SEMKKNIPQPLPIQSAQNSLYESEFISDDITEDPSKLDSSSFIPRSILRTATRFRKELNP DPGTEDDILNDFRNSRVRTRAAVSFVLGLMIVPLLTQQVSKNLVIGPFVDKLKGPEQIEI RINPEIENEVLTELARFEERLKFESLTSPIPLSPAEIQFQLKAKAEDLKEEYQWDLRQPL KNAISDLFSLVALAIYFVLNRQKIAVLKSFFDEIIYGLSDSAKAFIIILFTDVFVGFHSP HGWEVIVESVLSHFGLPQDRNFINMFIATFPVMLDTVFKYWIFRYLNQISPSAVATYRNM NE
Uniprot No.

Target Background

Function
PcxA is involved in light-induced Na(+)-dependent proton extrusion. It also appears to play a role in CO(2) transport.
Database Links
Protein Families
Cema family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Acaryochloris marina and why is it significant in photosynthesis research?

Acaryochloris marina is a unique marine cyanobacterium that represents a remarkable exception in photosynthetic organisms due to its ability to synthesize chlorophyll d as its primary photosynthetic pigment, with only trace amounts of chlorophyll a (3-5%) . This adaptation allows A. marina to efficiently utilize far-red light for photosynthesis, occupying ecological niches where other photosynthetic organisms cannot thrive . The organism has been isolated from various marine environments in association with other oxygenic phototrophs, suggesting its adaptive role in these ecosystems . The ability to use far-red light for oxygenic photosynthesis makes A. marina particularly valuable for understanding photosystem adaptations and alternative energy harvesting mechanisms in photosynthetic organisms .

What is the genomic context of pcxA in Acaryochloris marina?

The genome of Acaryochloris marina is exceptionally large for a bacterium, consisting of approximately 8.3 million base pairs, among the largest bacterial genomes sequenced to date . This genetic material is distributed across a main chromosome and nine single-copy plasmids that code for more than 25% of the putative open reading frames (ORFs) . The genome exhibits substantial duplication of genes related to DNA repair and recombination (primarily recA) and contains numerous transposable elements, which likely contribute to genetic mobility and genome expansion . While specific information about the pcxA gene's precise location within this genomic landscape is limited in the available literature, it would likely be part of the metabolic machinery involved in bioenergetic processes related to proton translocation and energy conservation mechanisms that support A. marina's unique photosynthetic capabilities.

How does PcxA protein function in relation to the unique photosynthetic apparatus of A. marina?

The PcxA protein in A. marina likely functions as part of the proton translocation machinery that supports the organism's unique photosynthetic process using chlorophyll d. In A. marina's photosynthetic apparatus, the photosystem I (PSI) reaction center contains a special pair (P740) consisting of a dimer of chlorophyll d and its epimer chlorophyll d' . The PSI reaction center is composed of 11 subunits and uses pheophytin a as the primary electron acceptor . While traditional cyanobacteria use phycobilisomes for light harvesting, A. marina contains phycobiliproteins (PBPs) that form rod-shaped complexes rather than typical phycobilisome structures . The proton extrusion functionality of PcxA would likely be essential for maintaining the proton gradients necessary for ATP synthesis during photosynthesis, particularly under the lower energy yield conditions associated with far-red light utilization.

What are the primary research challenges associated with recombinant PcxA production?

The production of recombinant PcxA from A. marina presents several significant challenges for researchers. First, A. marina possesses a distinct codon usage pattern compared to common expression hosts like E. coli, potentially necessitating codon optimization for efficient heterologous expression . Second, as a membrane-associated proton extrusion protein, PcxA likely contains hydrophobic domains that can cause protein aggregation and inclusion body formation during recombinant expression . Third, the correct folding and functionality of PcxA may depend on specific lipid environments present in A. marina but absent in typical expression systems . Fourth, the unique photosynthetic environment of A. marina, which utilizes chlorophyll d and operates under far-red light conditions, creates additional complexity in ensuring that recombinant PcxA maintains its native functional properties when produced in heterologous systems that lack these specialized components .

What expression systems are most suitable for recombinant PcxA production?

For recombinant production of membrane proteins like PcxA from A. marina, several expression systems merit consideration. E. coli-based systems offer rapid growth and high yield but may require significant optimization for membrane proteins. The BL21(DE3) strain with pET vector systems and C41/C43 strains specifically engineered for membrane protein expression represent viable options . For more challenging expression scenarios, eukaryotic systems such as Pichia pastoris might prove advantageous due to their enhanced capacity for post-translational modifications and membrane protein folding . When comparing expression efficiency, researchers should consider implementing a dual-approach methodology:

The selection should be guided by the specific research objectives, whether prioritizing structural studies requiring high purity or functional analyses necessitating proper folding and activity .

What purification strategies are most effective for maintaining PcxA stability and function?

Purification of recombinant PcxA requires specialized approaches to maintain protein stability and function. A multi-stage purification protocol typically yields the best results, beginning with careful cell lysis under controlled conditions to prevent protein denaturation. For membrane protein extraction, mild detergents such as n-dodecyl-β-D-maltoside (DDM), CHAPS, or digitonin are recommended as they effectively solubilize membrane proteins while preserving native conformations . Following extraction, affinity chromatography utilizing histidine or other fusion tags provides initial purification, followed by size exclusion chromatography to achieve higher purity and remove protein aggregates.

The choice of buffer systems significantly impacts protein stability during purification. Based on comparable studies with photosynthetic proteins from A. marina, researchers should consider:

Purification StageRecommended ConditionsCritical ParametersMonitoring Methods
Membrane Extraction50 mM Tris-HCl pH 7.5, 150-300 mM NaCl, 10% glycerol, 1-2% detergentDetergent:protein ratio, temperature control (4°C)Western blot, SDS-PAGE
Affinity ChromatographyImidazole gradient (20-300 mM), pH 7.5-8.0, detergent at CMCFlow rate, column volume ratioActivity assays, UV absorbance
Size Exclusion20 mM HEPES pH 7.5, 100 mM NaCl, detergent at 2-3x CMCSample concentration, injection volumeDynamic light scattering, FPLC chromatograms
Storage Conditions10% glycerol, -80°C storage or 4°C with protease inhibitorsFreeze-thaw cycles minimizationFunctional assays before/after storage

Researchers should validate protein functionality throughout the purification process using proton translocation assays in reconstituted liposomes or nanodiscs to ensure that native activity is preserved .

How can researchers assess the functional integrity of purified recombinant PcxA?

Assessing the functional integrity of purified recombinant PcxA requires multiple complementary approaches focusing on both structural characteristics and functional activities. For structural assessment, circular dichroism (CD) spectroscopy can verify proper secondary structure formation, while thermal shift assays help determine protein stability under various buffer conditions. Size exclusion chromatography coupled with multi-angle light scattering (SEC-MALS) provides critical information about the oligomeric state and homogeneity of the purified protein .

For functional characterization of proton extrusion activity, researchers should implement liposome-based assays where PcxA is reconstituted into artificial membrane systems. The following methodological approaches are recommended:

Functional AssayMethodologyKey ParametersExpected Results
pH-sensitive FluorescenceReconstitution with pH-sensitive dyes (BCECF, pyranine)Liposome composition, protein:lipid ratioFluorescence changes corresponding to proton translocation
Proton Flux MeasurementsACMA fluorescence quenching assayBuffer ionic strength, activating conditionsQuenching rate proportional to proton pumping activity
Patch-Clamp ElectrophysiologyProtein incorporation into planar lipid bilayersMembrane potential, solution compositionCurrent measurements reflecting ion channel activity
Coupled Enzyme AssaysATP synthesis couplingEnergetic coupling conditionsATP production rates

When interpreting results, researchers should consider the membrane composition's effects on activity, as A. marina's native membranes contain specialized lipids that may be necessary for optimal function . Control experiments using site-directed mutagenesis of predicted functional residues can confirm specific activity associated with the proton extrusion mechanism .

What structural features distinguish PcxA from other proton extrusion proteins in cyanobacteria?

The structural features of PcxA from A. marina likely reflect adaptations to the organism's unique photosynthetic environment utilizing chlorophyll d and far-red light. While detailed structural information specifically about PcxA is limited, comparative analysis with other cyanobacterial proton extrusion systems suggests several distinguishing features. PcxA likely contains transmembrane helices that form proton-conducting channels with specialized amino acid residues for proton coordination . The protein may also feature binding sites for cofactors that facilitate coupling to the photosynthetic electron transport chain optimized for the lower energy yield from far-red light photosynthesis.

Structural predictions based on homology modeling and protein family analysis would suggest:

Structural ElementLikely Features in PcxAFunctional SignificanceComparison to Other Cyanobacteria
Transmembrane Domains10-12 membrane-spanning helicesFormation of proton translocation pathwayMay contain adaptations for different membrane composition
Proton-Binding SitesConserved acidic residues (Asp, Glu)Direct involvement in proton coordination and transferSimilar core mechanism but potentially different regulatory sites
Regulatory DomainsPotential sensing regions for redox state or lightCoordination with photosynthetic activityAdapted to respond to far-red light photosynthesis signals
Protein-Protein Interaction SitesInterfaces for interaction with photosystemsIntegration with unique A. marina photosynthetic apparatusSpecialized for interaction with chlorophyll d-containing complexes

Researchers investigating these structural features should employ a combination of computational prediction methods, site-directed mutagenesis, and structural biology techniques such as cryo-electron microscopy, particularly given the advances in membrane protein structural determination demonstrated with A. marina's photosystem I .

How does the evolution of pcxA correlate with the acquisition of chlorophyll d-based photosynthesis in A. marina?

The evolution of pcxA in A. marina presents an intriguing question regarding its correlation with the species' unique adaptation to chlorophyll d-based photosynthesis. Genomic analysis reveals that A. marina possesses one of the largest bacterial genomes sequenced (8.3 million base pairs), with extensive gene duplication and evidence of horizontal gene transfer (HGT) . This genomic plasticity likely played a crucial role in the evolutionary acquisition of its distinctive photosynthetic machinery. Phylogenetic analysis of pcxA in comparison with homologous genes in other cyanobacteria could reveal whether this proton extrusion system evolved through:

  • Adaptive evolution of existing proton translocation machinery to accommodate the energetic requirements of chlorophyll d photosynthesis

  • Acquisition through horizontal gene transfer from other organisms

  • Gene duplication and subsequent functional specialization

The evolutionary trajectory of pcxA should be examined in the context of A. marina's genome plasticity, where approximately 25% of putative ORFs are located on nine single-copy plasmids . The heavy duplication of genes related to DNA repair and recombination, particularly recA, suggests mechanisms for genetic mobility that could have facilitated the acquisition or modification of genes like pcxA . Comparative genomic analysis between different A. marina strains, such as MBIC11017 (which retains phycobiliproteins) and MBIC10699 (a phycobiliprotein-less strain), could provide insights into the evolutionary relationship between proton extrusion systems and photosynthetic adaptations .

What is the relationship between PcxA activity and photosystem efficiency under varying light conditions?

The relationship between PcxA activity and photosystem efficiency under varying light conditions represents a critical research question for understanding A. marina's bioenergetic adaptations. A. marina has evolved to utilize far-red light efficiently through its chlorophyll d-based photosystems . The primary electron donor in photosystem I (PSI), known as P740, consists of a dimer of chlorophyll d and its epimer chlorophyll d', while the primary electron acceptor is pheophytin a . This unique composition allows the organism to harvest far-red light with wavelengths up to 30 nm red-shifted from chlorophyll a systems .

To investigate the relationship between PcxA activity and photosystem efficiency, researchers should design experiments that measure proton translocation rates under different spectral conditions:

Light ConditionWavelength Range (nm)Expected PcxA ActivityPhotosystem ResponseMeasurement Techniques
Far-red light700-750Potentially optimalHigh efficiency in A. marinaOxygen evolution, chlorophyll fluorescence
Red light650-700Moderate activityLess efficient absorptionP700/P740 oxidation kinetics
Green light500-550Minimal activityPoor absorptionProton gradient formation measurement
Blue light450-500Moderate activitySecondary absorption peakATP synthesis rates

The correlation between light quality and PcxA activity should be assessed through simultaneous measurement of proton gradient formation, electron transport rates, and ATP synthesis under controlled spectral conditions . This approach would elucidate whether PcxA has evolved specialized regulatory mechanisms that optimize its activity according to the available light spectrum, particularly in response to far-red light which is the predominant energy source for A. marina in its natural ecological niches .

How can site-directed mutagenesis of PcxA inform our understanding of proton translocation mechanisms in chlorophyll d-based photosynthesis?

Site-directed mutagenesis of PcxA represents a powerful approach for elucidating the molecular mechanisms underlying proton translocation in A. marina's unique chlorophyll d-based photosynthetic system. By systematically altering specific amino acid residues, researchers can identify key functional elements of the protein and their contributions to proton extrusion activity. A comprehensive mutagenesis strategy should target several categories of residues:

Residue CategoryRationale for TargetingExpected Functional ImpactAnalysis Methods
Predicted proton-binding sites (Asp, Glu, His)Direct involvement in proton coordinationAltered proton translocation kineticspH-sensitive fluorescence assays
Conserved residues across cyanobacterial homologsCore functional importancePotentially lethal or severely impaired functionComplementation studies
A. marina-specific residuesAdaptation to chlorophyll d photosynthesisModified efficiency under far-red lightSpectroscopic coupling assays
Transmembrane helix interface residuesChannel formation and regulationChanged proton selectivity or gatingElectrophysiology measurements
Potential regulatory domainsResponse to cellular energetic stateAltered activation/inhibition patternsActivity assays under varying conditions

Researchers should employ a systematic mutagenesis approach covering:

  • Alanine scanning of transmembrane domains to identify essential residues

  • Conservative substitutions to probe specific chemical requirements (e.g., Asp→Glu)

  • Charge reversal mutations to examine electrostatic contributions

  • Creation of chimeric proteins with homologs from chlorophyll a-containing cyanobacteria

The resulting mutant library should be characterized for expression, stability, membrane integration, and proton translocation activity . Correlation of these functional data with structural models would significantly advance our understanding of how PcxA's mechanism may be specially adapted to support the unique energetic requirements of chlorophyll d-based photosynthesis .

What are the implications of PcxA research for engineering artificial photosynthetic systems with expanded spectral ranges?

Research on A. marina's PcxA and its role in chlorophyll d-based photosynthesis has significant implications for engineering artificial photosynthetic systems with expanded spectral ranges. A. marina naturally demonstrates how photosynthetic organisms can adapt to utilize far-red light, expanding the usable solar spectrum beyond what conventional chlorophyll a-based systems can harvest . Understanding the molecular mechanisms of PcxA's proton extrusion activity in conjunction with chlorophyll d photosystems could inform several engineering approaches:

Engineering ApplicationRelevance of PcxA ResearchPotential BenefitsTechnical Challenges
Expanded-spectrum solar cellsInsights on energy transduction from far-red lightIncreased solar energy capture efficiencyIntegration of biological components with synthetic materials
Engineered crop plantsPotential for introducing far-red light utilizationEnhanced photosynthetic efficiency in canopy-shaded environmentsGenomic complexity of transplanting multiple components
Bioreactors for hydrogen/biofuel productionOptimized proton gradient formation for energy conversionImproved energy conversion efficiencyMaintaining system stability in artificial contexts
Synthetic carbon fixation systemsUnderstanding energy coupling requirementsMore efficient artificial carbon fixationBalancing proton translocation with carbon fixation energetics

To translate PcxA research into these applications, investigators should focus on:

  • Elucidating the minimal necessary components for functional far-red light photosynthesis

  • Determining how PcxA interfaces with the unique photosystems of A. marina

  • Identifying the critical adaptations that enable efficient proton translocation under lower energy input conditions

  • Developing methods to reconstitute these systems in synthetic membranes or alternative organisms

The unique adaptations of A. marina, including its extensive genome with specialized genes for photosynthesis and energy conversion, provide valuable blueprints for extending the spectral range of both natural and artificial photosynthetic systems . Successfully engineering these expanded-spectrum systems could significantly enhance solar energy utilization efficiency in both biological and synthetic applications.

What protocols are most effective for heterologous expression of recombinant PcxA?

For effective heterologous expression of recombinant PcxA from A. marina, researchers should implement a systematic protocol optimization approach. Based on experiences with other membrane proteins from photosynthetic organisms, the following comprehensive protocol framework is recommended:

Expression Vector Design:

  • Incorporate an N- or C-terminal affinity tag (His6, Strep-tag II) with a precision protease cleavage site

  • Consider fusion partners (MBP, SUMO) to enhance solubility

  • Include a strong but controllable promoter system (T7, tac, or araBAD)

  • Optimize codon usage for the expression host, particularly given A. marina's AT-rich genome

Expression Host Selection:

  • Primary screening in E. coli strains specialized for membrane proteins (C41/C43, Lemo21)

  • Secondary screening in eukaryotic systems (Pichia pastoris) if bacterial expression proves challenging

  • Consider cell-free expression systems for direct incorporation into nanodiscs

Expression Conditions Optimization Matrix:

ParameterVariables to TestMonitoring MethodSuccess Criteria
Induction temperature16°C, 20°C, 25°C, 30°CSDS-PAGE, Western blotHighest yield of full-length protein
Inducer concentration0.1-1.0 mM IPTG or 0.002-0.2% arabinoseWestern blot, activity assayBalance between expression level and protein quality
Media compositionLB, TB, autoinduction, minimal mediaGrowth curves, protein yieldOptimal biomass and protein production
Growth phase at inductionEarly log, mid-log, late logMembrane fraction analysisTiming for optimal membrane integration
Expression duration4h, 8h, 16h, 24hTime-course samplingMaximum yield of functional protein

Membrane Fraction Preparation:

  • Gentle cell lysis using enzymatic methods (lysozyme) combined with mild physical disruption

  • Differential centrifugation to isolate membrane fractions

  • Solubilization screening with a panel of detergents (DDM, LMNG, CHAPS)

This systematic approach, combined with functional screening assays, will identify optimal conditions for producing recombinant PcxA that retains its native structural and functional properties . Researchers should anticipate the need for extensive optimization given the unique properties of A. marina proteins adapted to its distinctive photosynthetic system.

What are the best approaches for studying PcxA interactions with photosystems in reconstituted systems?

Studying PcxA interactions with photosystems in reconstituted systems requires sophisticated approaches that maintain the functional integrity of these complex membrane protein assemblies. Given that A. marina utilizes chlorophyll d in its photosystems and has unique adaptations for far-red light photosynthesis, the reconstitution systems must be carefully designed to preserve these specialized features . The following methodological approaches are recommended:

Membrane Mimetic Systems Selection:

Reconstitution SystemAdvantagesLimitationsBest Applications
LiposomesNative-like bilayer environment, variable compositionHeterogeneous size, challenging for structural studiesFunctional assays, proton translocation measurements
NanodiscsDefined size, amenable to structural studiesLimited inner diameter, potentially constraining for large complexesSingle-molecule studies, cryo-EM structural analysis
ProteoliposomesCombined proteins in defined ratiosComplex preparation, potential co-purification issuesCoupled activity assays between PcxA and photosystems
Polymer-based systems (SMALPs)Direct extraction from membranes with native lipidsLimited control over final compositionMaintaining native interactions during purification

Co-reconstitution Strategies:

  • Sequential reconstitution: Incorporate photosystems first, followed by PcxA

  • Simultaneous reconstitution: Co-incorporate all components during liposome/nanodisc formation

  • Fusion approach: Separately reconstitute components and induce fusion of proteoliposomes

Interaction Analysis Techniques:

  • Functional Coupling Assays:

    • Light-driven proton pumping measurements using pH-sensitive dyes

    • ATP synthesis assays in co-reconstituted systems

    • Electron transport measurements using artificial electron acceptors/donors

  • Physical Interaction Studies:

    • Förster resonance energy transfer (FRET) between labeled components

    • Crosslinking-mass spectrometry to identify interaction interfaces

    • Co-immunoprecipitation with antibodies against specific components

  • Structural Approaches:

    • Single-particle cryo-electron microscopy of reconstituted complexes

    • Atomic force microscopy of membrane patches

    • Hydrogen-deuterium exchange mass spectrometry to identify interaction surfaces

These methods should be applied with careful attention to the specific requirements of A. marina proteins, particularly the light conditions (far-red light) and the presence of chlorophyll d in the photosystems . The reconstitution lipid composition should also be optimized to mimic the native membrane environment of A. marina, which may have unique lipid requirements compared to other cyanobacteria .

How can researchers effectively troubleshoot expression and purification challenges specific to PcxA?

Troubleshooting expression and purification challenges for recombinant PcxA requires a systematic approach targeting the specific difficulties associated with membrane proteins from A. marina. The unique properties of this cyanobacterium, including its distinctive photosynthetic machinery adapted for far-red light, create additional layers of complexity in heterologous protein production . Researchers should implement the following structured troubleshooting framework:

Expression Challenges and Solutions:

ChallengePotential CausesDiagnostic ApproachMitigation Strategies
Low expression levelsCodon bias, protein toxicity, promoter leakageRT-qPCR for mRNA levels, growth curve analysisCodon optimization, tighter promoter control, lower growth temperature
Truncated productsPremature translation termination, proteolysisWestern blot with N and C-terminal tagsOptimize rare codons, add protease inhibitors, use protease-deficient strains
Inclusion body formationRapid expression, improper folding, hydrophobicityFractionation and solubility analysisReduce induction strength, co-express chaperones, add membrane-mimicking additives
Membrane integration failureOverloaded secretion machinery, improper signal sequenceMembrane/cytoplasmic fractionationUse specialized strains (e.g., C41/C43), optimize membrane targeting sequences

Purification Troubleshooting Decision Tree:

  • Inefficient Solubilization:

    • Test expanded detergent panel (traditional: DDM, DM; novel: LMNG, GDN)

    • Optimize detergent:protein ratio and solubilization time

    • Consider detergent mixtures or addition of specific lipids

    • Implement systematic screening using fluorescence-detection size exclusion chromatography

  • Poor Affinity Purification:

    • Verify tag accessibility via dot blot or ELISA

    • Test alternative tag positions (N vs. C-terminus)

    • Optimize binding conditions (salt, pH, imidazole concentration)

    • Consider on-column detergent exchange

  • Protein Instability:

    • Implement thermal shift assays to identify stabilizing conditions

    • Screen additive panels (glycerol, specific lipids, small molecules)

    • Optimize buffer systems based on A. marina's native environment

    • Consider stabilizing mutations based on computational predictions

  • Aggregation During Concentration:

    • Determine concentration threshold for aggregation

    • Test alternative concentration methods (ultrafiltration vs. dialysis)

    • Add stabilizing agents (specific lipids, glycerol)

    • Assess aggregation state using dynamic light scattering

For each troubleshooting stage, researchers should implement controlled experiments with appropriate positive controls, such as well-characterized membrane proteins expressed under identical conditions . The unique characteristics of A. marina's proteins, adapted for its distinctive photosynthetic system utilizing chlorophyll d, should be considered when interpreting results and designing solutions to expression and purification challenges .

What are the emerging techniques that could advance PcxA research in the context of far-red light photosynthesis?

Research on PcxA and far-red light photosynthesis in A. marina stands to benefit significantly from several emerging techniques spanning structural biology, functional characterization, and synthetic biology approaches. These methodologies offer unprecedented opportunities to understand the unique adaptations of this remarkable cyanobacterium and its specialized proton extrusion systems .

Advanced Structural Biology Approaches:

TechniqueApplication to PcxA ResearchPotential Insights
Cryo-electron tomographyVisualization of PcxA in native membrane environmentSpatial relationship with photosystems and other membrane complexes
Microcrystal electron diffraction (MicroED)High-resolution structural analysis of small 3D crystalsDetailed proton translocation pathway architecture
Time-resolved serial crystallographyCapturing intermediate states during proton translocationMechanistic details of proton movement through the protein
AlphaFold2 and RoseTTAFoldAccurate structural prediction and model validationInitial structural models to guide experimental design

Functional Characterization Innovations:

  • Single-molecule techniques:

    • Single-molecule FRET to track conformational changes during activity

    • High-speed atomic force microscopy to observe dynamic structural changes

    • Optical tweezers combined with fluorescence to correlate force and function

  • Advanced spectroscopic methods:

    • Two-dimensional electronic spectroscopy to map energy transfer pathways

    • Time-resolved infrared spectroscopy to track protonation state changes

    • Magnetic resonance techniques (ENDOR, HYSCORE) to identify paramagnetic intermediates

  • Microfluidic approaches:

    • Droplet-based assays for high-throughput functional screening

    • Gradient-generating devices to test response to varying conditions

    • Artificial cell systems to reconstitute minimal functional units

Synthetic Biology and Systems Approaches:

  • Genome engineering tools:

    • CRISPR-Cas9 adaptation for A. marina genetic manipulation

    • Minimal synthetic systems reconstituting chlorophyll d photosynthesis

    • Transplantation of A. marina photosynthetic machinery into model organisms

  • Multi-omics integration:

    • Spatially resolved transcriptomics under different light conditions

    • Quantitative proteomics to map PcxA interactome

    • Metabolic flux analysis to quantify energetic efficiency

These emerging techniques, when applied to PcxA research, would provide unprecedented insights into how this proton extrusion protein contributes to A. marina's remarkable ability to harvest far-red light for oxygenic photosynthesis . The integration of these approaches would enable researchers to develop a comprehensive understanding of the structural adaptations, functional mechanisms, and evolutionary innovations that allow A. marina to thrive in its unique ecological niche.

How might understanding PcxA function contribute to bioengineering applications for renewable energy?

Understanding the function of PcxA in A. marina's unique far-red light photosynthetic system presents exciting opportunities for bioengineering applications in renewable energy. The ability of A. marina to efficiently utilize wavelengths of light that are inaccessible to most photosynthetic organisms represents a biological blueprint for expanding the spectral range of light-harvesting technologies . These insights could drive innovations across multiple renewable energy platforms:

Bioengineered Photosynthetic Systems:

Application AreaContribution from PcxA ResearchPotential Impact
Engineered photosynthetic microorganismsExtended light-harvesting spectrum30-40% increased solar spectrum utilization for biofuel production
Artificial photosynthetic systemsOptimized proton gradient generationEnhanced efficiency in water splitting and hydrogen production
Biohybrid solar cellsIntegration of biological light-harvesting with solid-state componentsNovel photovoltaics with expanded spectral response
Carbon sequestration technologiesEngineered organisms with enhanced far-red light utilizationImproved biological carbon capture systems for industrial emissions

Practical Implementation Pathways:

  • Synthetic biology approaches:

    • Transfer of minimal chlorophyll d biosynthesis and utilization pathways, including PcxA, to model organisms

    • Creation of chimeric photosystems incorporating features from A. marina and conventional photosynthetic organisms

    • Development of synthetic protein scaffolds to optimize spatial arrangement of photosynthetic components

  • Biohybrid technologies:

    • Integration of purified PcxA and photosystems into artificial membranes coupled with electrodes

    • Development of photo-bioelectrochemical cells utilizing far-red light

    • Creation of self-assembling nanoscale architectures mimicking A. marina's efficient energy conversion

  • Practical engineering considerations:

    • Stability enhancement for industrial applications

    • Scalable production systems for bioengineered components

    • Integration with existing renewable energy infrastructure

The potential energy conversion efficiency gains from incorporating insights from A. marina's PcxA and associated far-red light photosynthetic machinery are substantial. Conventional photosynthesis typically utilizes only approximately 45% of the incident solar spectrum, while inclusion of far-red light harvesting could theoretically extend this by an additional 15-20% . This expansion represents a significant untapped resource for bioenergy applications, particularly in environments where light quality is skewed toward the far-red region of the spectrum, such as dense microbial communities, aquatic environments at depth, or under plant canopies .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.