Recombinant Acaryochloris marina UPF0754 membrane protein AM1_5604 (AM1_5604)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, and this can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
AM1_5604; UPF0754 membrane protein AM1_5604
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-409
Protein Length
full length protein
Species
Acaryochloris marina (strain MBIC 11017)
Target Names
AM1_5604
Target Protein Sequence
MDWSTLGVVIVPPIAGGIIGYFTNDLAISMLFKPYRAIKIGDRRLPFTPGLIPRNQERLA QKVSDAIMTSLLTPEELQAIAQRLLQTERVQGAIFWLLQLALDQVKSDTGQRTAQILANI LRDFADQSLPRIIVALARREDFLQDQLDQVFDQVLLDLQLTDDQAQQLANWIINVVVPPD TLRLLLIDFLTDRNIAILDRDLRTKTSGTYWLVANVMGVQSSLVKLRTFCIEEKLACNAI VAELLTSLGIRQRFVEWLASLSLQNLPVRTVRQLRQQFRESVRGYTQNKGISVLQNLGTS VDWDETAMLIVKRLQTSEVVTTSLKDISEDLALILERYLERDLEMIVVKALPILNLDQVI IDRVNHTAPEDLEAAIQGIVKTELQAIVILGGVLGIVIGLLQSLILLFS
Uniprot No.

Target Background

Database Links
Protein Families
UPF0754 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Acaryochloris marina UPF0754 membrane protein AM1_5604 and what makes it significant for research?

The UPF0754 protein (AM1_5604) is a 409-amino acid membrane protein found in Acaryochloris marina, a unique cyanobacterium that predominantly uses chlorophyll d instead of chlorophyll a in its photosystems . This protein belongs to the UPF (Uncharacterized Protein Family) class, indicating its function remains partially undefined. Its significance lies in its potential role in A. marina's unique photosynthetic machinery, which enables this organism to harvest far-red light that is inaccessible to most photosynthetic organisms . Understanding AM1_5604 may provide insights into alternative photosynthetic mechanisms and membrane protein evolution in specialized light environments.

How does AM1_5604 compare structurally to other membrane proteins in Acaryochloris marina?

AM1_5604, with its 409 amino acids, represents one of the characterized membrane proteins in A. marina . Unlike other proteins such as UPF0246 (AM1_4276), where length and subcellular localization remain undefined, AM1_5604 has been definitively identified as membrane-associated. Comparative analysis suggests potential structural relationships with components involved in A. marina's unique photosynthetic apparatus, which includes extensive patches of near-crystalline phycobiliprotein rods associated with photosynthetic membranes . The protein's structure likely reflects adaptations for functioning within A. marina's specialized thylakoid membrane organization that physically separates photosystem I and photosystem II reaction centers .

What expression systems are most effective for producing recombinant AM1_5604 protein?

For recombinant production of AM1_5604, Escherichia coli expression systems have proven most effective based on available data . The protein can be successfully expressed as a His-tagged construct, facilitating purification through affinity chromatography methods. When designing expression systems for AM1_5604, researchers should consider:

  • Codon optimization for E. coli expression

  • Selection of appropriate fusion tags (His-tag being most common)

  • Expression temperature optimization (typically 16-25°C) to prevent inclusion body formation

  • Membrane protein-specific extraction protocols using mild detergents

This approach differs from expression strategies for other A. marina proteins that may require alternative hosts or specialized solubilization techniques based on their specific biochemical properties.

What are the recommended protocols for purifying recombinant AM1_5604 from E. coli cultures?

For optimal purification of recombinant His-tagged AM1_5604 from E. coli expression systems, the following methodology is recommended:

  • Cell lysis: Gentle disruption using either sonication or enzymatic methods with lysozyme in buffer containing protease inhibitors

  • Membrane fraction isolation: Sequential centrifugation (10,000×g followed by 100,000×g ultracentrifugation)

  • Solubilization: Treatment with appropriate detergents (n-dodecyl-β-D-maltoside or CHAPS at 1-2%)

  • Purification: Nickel affinity chromatography using imidazole gradient elution

  • Secondary purification: Size exclusion chromatography to remove aggregates

This protocol has proven effective for isolating functional membrane proteins from A. marina when expressed in heterologous systems, yielding protein suitable for structural and functional studies .

How can researchers effectively analyze AM1_5604 interactions with photosynthetic complexes?

To investigate potential interactions between AM1_5604 and photosynthetic complexes, researchers should employ a multi-technique approach:

  • Co-immunoprecipitation studies using antibodies against known photosystem components

  • Crosslinking mass spectrometry to identify proximal proteins in the membrane

  • Blue native PAGE coupled with western blotting to preserve native protein-protein interactions

  • Bimolecular fluorescence complementation (BiFC) for in vivo interaction verification

  • Cryo-electron microscopy, analogous to methods used for visualizing A. marina's phycobiliprotein structures

This methodological approach recognizes that A. marina's photosynthetic membranes contain unique organizational features, including the physical separation of photosystem I and photosystem II reaction centers . When designing experiments, researchers should account for the possibility that AM1_5604 may participate in this specialized membrane architecture.

What bioinformatic approaches best predict the potential function of AM1_5604?

For predicting AM1_5604 function, a comprehensive bioinformatic pipeline is recommended:

  • Sequence-based analysis:

    • Profile hidden Markov models for distant homology detection

    • Conserved domain identification across cyanobacterial genomes

    • Transmembrane topology prediction (TMHMM, Phobius)

  • Structure-based prediction:

    • AlphaFold2 or RoseTTAFold for ab initio structure prediction

    • Structural alignment with known membrane proteins

    • Binding pocket and active site prediction

  • Genomic context analysis:

    • Operon structure examination

    • Co-expression patterns with known photosynthetic genes

    • Phylogenetic profiling across chlorophyll d-containing organisms

This multi-faceted approach is particularly valuable given the limited experimental data on AM1_5604 and should incorporate knowledge about A. marina's unique light-harvesting capabilities in far-red light environments .

How might AM1_5604 contribute to A. marina's unique chlorophyll d-based photosynthetic mechanism?

Based on current understanding of A. marina's photosynthetic apparatus, AM1_5604 may contribute to chlorophyll d-based photosynthesis through several potential mechanisms:

  • Assembly or stabilization of specialized membrane protein complexes that accommodate chlorophyll d

  • Facilitation of energy transfer between phycobiliprotein structures and photosystems

  • Adaptation of membrane architecture to support the physical separation of photosystem I and II reaction centers observed in A. marina

  • Optimization of membrane properties for function under far-red light conditions

A. marina's ability to perform photosynthesis using predominantly chlorophyll d (>90% of total chlorophyll) rather than chlorophyll a represents a significant evolutionary adaptation . Membrane proteins like AM1_5604 likely play crucial roles in maintaining the structural organization required for efficient light harvesting under these specialized conditions.

How can CRISPR-Cas9 gene editing be optimized for studying AM1_5604 function in A. marina?

Developing a CRISPR-Cas9 system for A. marina requires specific considerations:

  • Delivery method optimization:

    • Electroporation protocols adapted for A. marina's unique cell wall structure

    • Conjugation-based plasmid transfer systems

    • Development of A. marina-specific expression vectors

  • Guide RNA design:

    • Target selection accounting for A. marina's high GC content

    • Off-target prediction tools calibrated for the A. marina genome

    • PAM site accessibility considerations in membrane protein genes

  • Phenotypic analysis:

    • Growth rate measurements under varying light conditions (NIR vs. visible light)

    • Photosynthetic efficiency quantification using oxygen evolution measurements

    • Membrane ultrastructure examination via cryo-electron microscopy

This methodology builds upon techniques established for studying A. marina's photosynthetic capabilities under near-infrared radiation and enables precise genetic manipulation for functional studies of AM1_5604.

What are the challenges and solutions for crystallizing AM1_5604 for structural determination?

The crystallization of membrane proteins like AM1_5604 presents several challenges that can be addressed through specialized approaches:

ChallengeSolution StrategyTechnical Details
Detergent selectionSystematic screeningTest n-dodecyl-β-D-maltoside, LDAO, and novel calixarene-based detergents
Protein stabilityThermal shift assaysIdentify stabilizing buffers and additives (pH 6.0-8.0, 100-500 mM NaCl)
Crystal packingFusion protein approachesConsider T4 lysozyme or BRIL fusion constructs
Phase determinationHeavy atom derivativesSelenomethionine incorporation or tantalum cluster soaking
Microcrystal formationSerial crystallographyX-ray free-electron laser (XFEL) or synchrotron-based methods

These strategies draw upon successful approaches for other cyanobacterial membrane proteins while addressing the specific challenges of AM1_5604. Researchers should also consider lipidic cubic phase (LCP) crystallization as an alternative to traditional vapor diffusion methods .

How does AM1_5604 relate phylogenetically to membrane proteins in other Acaryochloris species?

Phylogenetic analysis of AM1_5604 should consider:

  • Sequence conservation across:

    • Different A. marina strains, including MBIC11017 and closely related strains like MU13

    • Other members of the Acaryochloris genus, including the chlorophyll b-producing A. thomasi RCC1774

    • Cyanothece sp. PCC7425 and other related cyanobacteria

  • Evolutionary patterns:

    • Rates of synonymous vs. non-synonymous substitutions to identify selective pressures

    • Genome-wide amino acid phylogeny using single-copy orthologous genes

    • Analysis of horizontal gene transfer signatures that might explain protein evolution

This comparative approach should be integrated with our understanding of Acaryochloris evolution, particularly the recently derived clade of tunicate-associated strains to which MBIC11017 belongs . The analysis may reveal whether AM1_5604 represents a conserved ancestral protein or a more recent adaptation associated with specific ecological niches.

What insights can comparative proteomics provide about AM1_5604's role across different growth conditions?

Comparative proteomic analysis of AM1_5604 expression should include:

  • Growth condition variables:

    • Light quality (NIR vs. visible light)

    • Growth mode (planktonic vs. biofilm)

    • Oxygen concentration (anoxic to hyperoxic conditions)

  • Analytical approaches:

    • Quantitative proteomics using SILAC or TMT labeling

    • Protein-protein interaction mapping under different conditions

    • Post-translational modification analysis, particularly phosphorylation states

    • Membrane proteome fractionation to examine stoichiometric relationships

This methodology builds on established approaches for studying A. marina under varied conditions, recognizing that this organism shows remarkable adaptability to different light environments and growth modes . Comparative proteomic data would reveal whether AM1_5604 expression and interaction patterns change in response to environmental variables, providing functional insights.

How might AM1_5604 contribute to synthetic biology applications in alternative photosynthesis?

AM1_5604 presents several opportunities for synthetic biology applications:

  • Photosynthetic efficiency enhancement:

    • Engineering of chimeric photosystems incorporating AM1_5604 and chlorophyll d

    • Development of minimal synthetic membranes with optimized light-harvesting capabilities

    • Creation of artificial photosynthetic systems capable of utilizing far-red light

  • Biotechnological approaches:

    • Expression of AM1_5604 alongside chlorophyll d biosynthesis genes in model organisms

    • CRISPR-mediated integration of AM1_5604 into alternative photosynthetic systems

    • Protein engineering to enhance stability or modify spectral properties

These applications leverage A. marina's unique adaptation to harvest far-red light through chlorophyll d-based photosynthesis . Understanding AM1_5604's role could enable the development of enhanced photosynthetic systems with expanded spectral ranges for both fundamental research and applied biotechnology.

What role might AM1_5604 play in A. marina's adaptation to different ecological niches?

The ecological significance of AM1_5604 should be evaluated through:

  • Comparative expression analysis across:

    • Natural A. marina populations from different habitats

    • Laboratory strains grown under conditions mimicking natural environments

    • Different Acaryochloris species occupying distinct ecological niches

  • Ecological adaptation mechanisms:

    • Potential role in biofilm formation capabilities

    • Contribution to photosynthetic efficiency under far-red light

    • Association with specific hosts (e.g., tunicates like Lissoclinum species)

A. marina strains have been isolated from diverse habitats, including didemnid ascidians, suggesting ecological versatility . AM1_5604's potential contribution to this adaptability, particularly in relation to the organism's unique photosynthetic capabilities under both visible and near-infrared radiation, represents an intriguing area for investigation that bridges molecular biology and ecology.

What are the most promising research directions for understanding AM1_5604 function?

The most promising research avenues for AM1_5604 include:

  • Structural biology:

    • Cryo-EM structure determination in native membrane environment

    • Identification of interaction partners through proximity labeling approaches

    • In silico modeling of dynamic membrane interactions

  • Functional genomics:

    • CRISPR-based knockout studies coupled with phenotypic analysis

    • Conditional expression systems to study essentiality

    • Heterologous expression in model cyanobacteria

  • Integration with systems biology:

    • Multi-omics approaches combining transcriptomics, proteomics, and metabolomics

    • Network analysis of AM1_5604 within the broader context of A. marina metabolism

    • Computational modeling of membrane protein dynamics

These approaches collectively address the significant knowledge gaps regarding AM1_5604 function while leveraging our understanding of A. marina's unique photosynthetic adaptations .

How will advancing knowledge of AM1_5604 contribute to our broader understanding of photosynthetic diversity?

Advancing our understanding of AM1_5604 will contribute to broader photosynthetic research through:

  • Evolutionary insights:

    • Better characterization of divergent photosynthetic mechanisms

    • Understanding of parallel and convergent evolution in light-harvesting systems

    • Insights into the evolutionary plasticity of photosynthetic membranes

  • Fundamental photosynthesis knowledge:

    • Expanded understanding of how membrane architecture influences photosynthetic efficiency

    • New perspectives on photosystem organization and energy transfer mechanisms

    • Insights into adaptation to specialized light environments

  • Biotechnological applications:

    • Development of photosynthetic systems with expanded spectral range utilization

    • Design principles for synthetic photosynthetic membranes

    • Novel approaches for enhancing photosynthetic productivity

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.