Recombinant Acetobacter pasteurianus Protein translocase subunit SecD (secD)

Shipped with Ice Packs
In Stock

Description

Gene and Protein Structure

  • Gene Name: secD (also annotated as Selin_2365 in some strains) .

  • Protein: A membrane-bound component of the SecDF-YajC subcomplex within the Sec translocase system. The full-length protein comprises 521 amino acids (UniProt ID: C7JGJ8) .

  • Domains: Features conserved regions for interaction with SecF and periplasmic domains involved in proton motive force-driven translocation .

Recombinant Production

  • Host Systems: Expressed in E. coli, yeast, baculovirus, or mammalian cells, with yields ≥85% purity confirmed via SDS-PAGE .

  • Tags: Often includes an N-terminal His tag for purification .

  • Storage: Stabilized in Tris-based buffer with 50% glycerol at -20°C to -80°C .

Functional Role in Acetobacter pasteurianus

The SecD subunit collaborates with SecF and YajC to enhance the efficiency of protein translocation. Key functions include:

  • Post-Translational Translocation: Assists in threading preproteins through the SecYEG channel .

  • Proton Motive Force Utilization: Converts electrochemical gradients into mechanical energy to drive substrate movement .

  • Acetic Acid Resistance: Indirectly supports acid tolerance by ensuring proper folding and localization of membrane-bound dehydrogenases (e.g., AldFGH complex) .

Table 1: Key Interactions of SecD in A. pasteurianus

Interaction PartnerFunctional RoleCitation
SecFStabilizes SecYEG channel
AldFGH ComplexFacilitates membrane anchoring of dehydrogenases
TAT SystemCoordinates with twin-arginine translocase for folded protein secretion

Biochemical Studies

  • Enzyme Reconstitution: Used to rebuild membrane protein complexes in vitro. For example, mixing recombinant SecD with AldGH subcomplex restored aldehyde dehydrogenase activity in A. pasteurianus membranes .

  • Protein Localization: Tagged variants enable tracking of SecDF-YajC dynamics via fluorescence microscopy .

Industrial Relevance

  • Vinegar Production: Enhanced understanding of SecD’s role in acetic acid bacteria supports strain optimization for high-yield fermentation .

Comparative Genomic Insights

Genomic analysis of A. pasteurianus strains (e.g., CICC 20001 and CGMCC 1.41) reveals:

  • Chromosomal Conservation: secD is evolutionarily conserved across strains, underscoring its essential role .

  • Plasmid Variability: Regulatory elements adjacent to secD differ, suggesting strain-specific adaptations .

Challenges and Future Directions

  • Structural Resolution: The lack of a high-resolution SecD crystal structure limits mechanistic insights .

  • Engineering Applications: CRISPR-Cas9 editing of secD could optimize protein secretion in industrial strains .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, kindly indicate them during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipment, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors such as storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
secD; APA01_10580; Protein translocase subunit SecD
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-521
Protein Length
full length protein
Species
Acetobacter pasteurianus (strain NBRC 3283 / LMG 1513 / CCTM 1153)
Target Names
secD
Target Protein Sequence
MRMYYSRLKLASVLGVCLLGLLLCLPNGMRKPFPSIPWRQIHLGLDLRGGSYLLMQVDLK SLTHDRLQTLAENTRDTLLKSQLGYQNINVDADKNTVSFQPRDAAEADTDVATLDKLPRV VPNEFSVKKQDDGTIALVLSADAIKARAREAVTQSIEIVRRRIDGTGAVDPEITRQGDDR IVVELPGISDPERIKALLGTTAKMTFRLVDSNPLHATYPPPGVSLVPMANPAEGGPLPVF DHVDVDGTDLTNAGAVIDQQTGEWAVSFSFDSVGTRAFSSVTQTNVGKRFAIVLDNKVIE APVIRTPITGGNGQITGGFDAQKATDLALMLRAGALPAPLSVVEQRSIGPSLGADSIRAG ILSLGVGFLLVVVFMVLFYGRFGWYADIALLANLVLMVAILSLFEATLTLPGMAGMLLTL GMAVDANILINERIREEVARGRTPLAAMQTGFERATSTIVDSNATAFLAHVMLFVFGTGP VRGFALTITIGIATTLFTTLLLSRMLMARWYARTRPASLPV
Uniprot No.

Target Background

Function
This protein is a component of the Sec protein translocase complex. It interacts with the SecYEG preprotein conducting channel. SecDF utilizes the proton motive force (PMF) to complete protein translocation after the ATP-dependent function of SecA.
Database Links
Protein Families
SecD/SecF family, SecD subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What genomic features of Acetobacter pasteurianus should be considered when designing recombinant SecD expression systems?

Genomic analysis of Acetobacter pasteurianus strains reveals important considerations for recombinant protein expression. The genome comparison of industrially relevant strains (CICC 20001 and CGMCC 1.41) with other sequenced strains demonstrates that while chromosomes are evolutionarily conserved, plasmids display unique characteristics . These genomic features create a balance between instability factors and stability factors that contribute to the genetic stability of A. pasteurianus strains, which is consistent with their stable industrial performances .

When designing recombinant SecD expression systems, researchers should consider:

  • The evolutionary conservation of chromosomal genes versus the uniqueness of plasmid-encoded genes

  • The balance of genomic stability factors that might affect expression consistency

  • The native genetic context of the secD gene to preserve functional interactions

Methodologically, whole-genome sequencing and comparative genomic analysis provide the foundation for informed genetic engineering approaches. The chromosomal location and regulatory elements of secD should be characterized before designing expression constructs.

How does the acetic acid resistance phenotype relate to membrane protein function in Acetobacter pasteurianus?

Acetic acid resistance in A. pasteurianus involves complex mechanisms potentially linked to membrane protein function. Analysis of acid-tolerant metabolic pathways at the genomic level indicates that amino acid metabolism and known mechanisms of acetic acid tolerance likely work collaboratively to confer resistance . Specifically, aspartic acid and glutamate significantly enhance acid stress resistance and metabolism in A. pasteurianus through multiple mechanisms .

The relationship between membrane proteins and acid resistance is multifaceted:

  • Proteomic studies reveal that acid stress alters membrane polysaccharide composition, with PATAg-specific staining showing modifications under acidic conditions

  • Cell size reduction (approximately 30% in length) occurs in response to acidity, suggesting membrane remodeling

  • Amino acids like aspartic acid and glutamate enhance unsaturated fatty acid synthesis and lipid transport, improving cytomembrane integrity under acid stress

For SecD research, these findings suggest that protein translocation systems may play critical roles in membrane remodeling and stress response, potentially by facilitating the secretion of proteins involved in cell wall modifications or acid resistance mechanisms.

What expression systems are most effective for producing recombinant membrane proteins like SecD in Acetobacter pasteurianus?

Based on successful membrane protein expression in A. pasteurianus, the following methodological approach is recommended:

  • Vector selection: The pBBR-based broad-host-range vectors have proven effective for protein overexpression in A. pasteurianus, as demonstrated in studies with PQQ-ADH . For SecD expression, similar plasmid constructs can be adapted.

  • Promoter consideration: Native promoters from highly expressed A. pasteurianus genes often yield better results than heterologous promoters, particularly for membrane proteins.

  • Expression conditions: Growth parameters significantly impact membrane protein expression. For A. pasteurianus, optimal conditions include:

    • Temperature: 30°C (standard) or 38-41°C (for thermotolerant strains)

    • pH: Initial pH 6.0-6.5 with controlled acidification

    • Aeration: High aeration rates (vvm > 0.5) to support aerobic metabolism

  • Codon optimization: Codon usage analysis of highly expressed membrane proteins in A. pasteurianus should guide recombinant SecD design to overcome potential translational limitations.

The construction of the expression system should follow validated molecular biology techniques as described in Wu et al., where gene amplification, restriction enzyme digestion, and ligation into expression vectors were successfully employed for membrane protein expression .

What purification strategies overcome the challenges associated with membrane protein isolation from Acetobacter pasteurianus?

Purification of membrane proteins like SecD from A. pasteurianus requires specialized approaches to overcome their hydrophobic nature and maintain structural integrity:

  • Membrane fraction isolation:

    • Cell disruption by sonication in buffer containing 50 mM Tris-HCl (pH 8.0), 150 mM NaCl, and protease inhibitors

    • Differential centrifugation: low-speed centrifugation (10,000×g, 20 min) followed by ultracentrifugation (100,000×g, 1 hour)

    • Membrane solubilization using mild detergents (DDM or LDAO at 1-2%)

  • Chromatographic separation:

    • Immobilized metal affinity chromatography (IMAC) for His-tagged SecD

    • Size exclusion chromatography to separate protein complexes

    • Ion exchange chromatography for final polishing

  • Stability enhancement:

    • Addition of glycerol (10-20%) to all buffers

    • Inclusion of specific lipids that maintain membrane protein stability

    • Maintenance of acidic pH (5.0-6.0) to mimic native conditions

Proteomic approaches employed in A. pasteurianus studies, such as 2D-PAGE, have successfully identified 53 relevant proteins during acetic fermentation , suggesting these techniques can be adapted for SecD isolation and characterization.

How can researchers assess the role of SecD in protein translocation across Acetobacter pasteurianus membranes?

Methodological approaches to characterize SecD function in A. pasteurianus should include:

  • Gene knockout and complementation studies:

    • CRISPR-Cas9 or homologous recombination to generate secD deletion mutants

    • Phenotypic assessment focusing on growth rates, acid resistance, and protein secretion profiles

    • Complementation with wild-type and mutant secD variants to confirm function

  • Protein translocation assays:

    • In vivo assessment using reporter proteins (alkaline phosphatase fusions) to monitor secretion efficiency

    • In vitro reconstitution of the Sec translocase system using purified components

    • Quantification of secreted versus cytoplasmic protein fractions under various stress conditions

  • Interaction studies:

    • Co-immunoprecipitation to identify SecD interaction partners

    • Bacterial two-hybrid analysis to map interaction domains

    • Cross-linking studies to capture transient interactions during translocation

These approaches should be conducted under various physiological conditions, particularly during exposure to acetic acid stress, to understand how SecD function might contribute to acid resistance mechanisms identified in A. pasteurianus .

What biophysical techniques are suitable for studying SecD structure and dynamics in Acetobacter pasteurianus?

Structural and dynamic characterization of membrane proteins like SecD requires specialized biophysical techniques:

  • Cryo-electron microscopy (cryo-EM):

    • Single-particle analysis for high-resolution structural determination

    • Subtomogram averaging to visualize SecD in native membrane environments

    • Sample preparation should preserve protein in native-like lipid environments

  • Spectroscopic approaches:

    • Circular dichroism (CD) to assess secondary structure composition

    • Fluorescence spectroscopy with site-specific labels to monitor conformational changes

    • Electron paramagnetic resonance (EPR) with spin labels to measure domain movement

  • Mass spectrometry applications:

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to map dynamic regions

    • Crosslinking mass spectrometry to identify interaction interfaces

    • Native mass spectrometry to analyze complex formation and stability

  • Molecular dynamics simulations:

    • Based on homology models derived from related bacterial SecD structures

    • Simulations of SecD in membranes with varying lipid compositions to mimic A. pasteurianus environment

    • Assessment of protein behavior under different pH conditions to model acetic acid stress

These techniques can provide insights into how SecD structure and dynamics might respond to the acidic conditions encountered during acetic acid fermentation, potentially revealing mechanisms of acid adaptation at the molecular level.

How might SecD function contribute to the acid resistance mechanisms of Acetobacter pasteurianus?

Analysis of acid resistance mechanisms in A. pasteurianus suggests potential roles for protein translocation systems like SecD:

  • Cell envelope modification pathway:

    • SecD may facilitate the translocation of proteins involved in cell envelope modifications that contribute to acid resistance

    • Proteomic studies have shown morphological changes in A. pasteurianus under acid stress, including cell size reduction and membrane polysaccharide modifications

    • SecD could be essential for secreting enzymes that synthesize or modify protective outer membrane components

  • Stress response protein secretion:

    • Genomic analysis indicates that metabolism of certain amino acids contributes to acetic acid resistance in A. pasteurianus strains

    • SecD might be required for efficient translocation of proteins involved in amino acid metabolism or transport

    • The protein may play a role in secreting proteins that contribute to maintaining intracellular pH homeostasis

  • Proton gradient regulation:

    • As a component of the SecDF complex that utilizes the proton motive force, SecD function may be directly linked to proton gradient maintenance

    • Under acidic conditions, efficient protein translocation by SecD could help preserve cellular energy that would otherwise be diverted to managing proton influx

Experimental approaches should include comparative proteomic analysis of wild-type versus secD mutant strains under acid stress to identify SecD-dependent secreted proteins that contribute to acid resistance.

What insight can comparative genomics provide about SecD conservation and specialization across Acetobacter species?

Comparative genomic approaches offer valuable insights into SecD evolution and specialization:

  • Sequence conservation analysis:

    • Alignment of SecD sequences from multiple Acetobacter species reveals conserved domains and species-specific variations

    • Identification of residues under positive selection that may contribute to acid adaptation

    • Correlation between SecD sequence variation and species-specific acid tolerance

  • Genomic context evaluation:

    • Analysis of the genetic neighborhood of secD across species to identify conserved operons

    • Assessment of regulatory elements that might control secD expression under different conditions

    • Identification of co-evolved genes that may functionally interact with SecD

  • Evolutionary trajectory mapping:

    • Phylogenetic analysis to trace SecD evolution across Acetobacter and related genera

    • Identification of horizontal gene transfer events that might have contributed to SecD specialization

    • Correlation between SecD evolutionary patterns and ecological niches of different Acetobacter species

The genomic comparisons of A. pasteurianus strains have already revealed that chromosomes are evolutionarily conserved while plasmids show significant variation . Similar approaches focused specifically on secD and related genes could reveal how protein translocation systems have evolved to support the unique lifestyle of acetic acid bacteria.

What strategies can overcome common challenges in genetic manipulation of Acetobacter pasteurianus for SecD studies?

Genetic manipulation of A. pasteurianus presents several challenges that can be addressed through targeted approaches:

  • Transformation efficiency limitations:

    • Optimization of electroporation parameters (voltage: 2.0-2.5 kV, resistance: 200 Ω, capacitance: 25 μF)

    • Use of methylation-deficient E. coli strains for plasmid preparation to avoid restriction barriers

    • Development of conjugation protocols using E. coli donor strains (demonstrated success in PQQ-ADH studies)

  • Genetic stability concerns:

    • Selection of stable integration sites based on genomic stability analysis

    • Use of broad-host-range plasmids with appropriate selection markers

    • Implementation of inducible expression systems to minimize mutational escape

  • Phenotypic verification challenges:

    • Development of specific assays to measure SecD activity

    • Use of reporter gene fusions to quantify translocation efficiency

    • Complementation studies with well-characterized SecD homologs

The successful genetic manipulation approaches demonstrated in the overexpression of PQQ-ADH in A. pasteurianus provide a methodological framework that can be adapted for SecD studies, with appropriate modifications to account for the membrane protein nature of SecD.

How can researchers differentiate between direct and indirect effects when studying SecD function in Acetobacter pasteurianus?

Distinguishing direct from indirect effects is crucial for accurate functional characterization of SecD:

  • Conditional expression systems:

    • Tight control of secD expression using inducible promoters

    • Time-course analysis following SecD depletion or induction

    • Quantitative correlation between SecD levels and phenotypic outcomes

  • Site-directed mutagenesis approach:

    • Construction of point mutations affecting specific SecD functions

    • Creation of catalytically inactive variants that maintain structural integrity

    • Complementation with heterologous SecD proteins with known functional differences

  • Proteomic and transcriptomic differential analysis:

    • Comparison of proteome and transcriptome changes in wild-type versus secD mutant strains

    • Identification of immediate versus delayed responses following SecD perturbation

    • Network analysis to map primary and secondary effects

  • In vitro reconstitution:

    • Purification of SecD and associated components for in vitro translocation assays

    • Direct measurement of translocation activity with purified components

    • Assessment of specific substrates whose translocation depends on SecD function

These approaches can help researchers establish causality in SecD function studies, distinguishing its direct role in protein translocation from indirect effects on cellular physiology and stress response in A. pasteurianus.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.