Recombinant Acetylcholine receptor subunit alpha-type acr-16 (acr-16)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

Recombinant Acetylcholine receptor subunit alpha-type ACR-16 (acr-16) is a nicotinic acetylcholine receptor (nAChR) subunit found in nematodes. It forms homopentameric ligand-gated ion channels critical for neuromuscular signaling . ACR-16 is evolutionarily related to vertebrate α7 nAChRs and mediates non-levamisole-sensitive cholinergic currents at neuromuscular junctions (NMJs) . Genetic studies in Caenorhabditis elegans show that ACR-16-containing receptors are essential for locomotion, as double mutants lacking both levamisole-sensitive receptors and ACR-16 exhibit abolished synaptic currents and paralysis .

Functional Expression and Accessory Proteins

Functional reconstitution of ACR-16 in heterologous systems (e.g., Xenopus oocytes) requires co-expression with accessory proteins:

Accessory ProteinRole in ACR-16 ExpressionExample SpeciesCurrent Response (nA)
RIC-3Chaperone for receptor foldingC. elegans1,000–2,000
EMC-6ER membrane complex componentBrugia malayi17 ± 4
NRA-2/NRA-4Subunit assembly regulatorsB. malayi4 ± 2
  • Expression kinetics: Earlier clade III receptors (e.g., A. suum) reach maximal currents in 2 days, while derived species like B. malayi require ≥3 days .

  • Species-specific dependencies: B. malayi ACR-16 requires RIC-3 + EMC-6 or RIC-3 + NRA-2/NRA-4 for detectable currents , whereas Necator americanus ACR-16 depends on RIC-3 but shows diminished responses over time .

Pharmacological Properties

ACR-16 exhibits distinct agonist affinities and sensitivities:

Agonist Efficacy (EC₅₀ Values)

SpeciesAcetylcholine (μM)Nicotine (μM)
A. suum8.9 [8.2–9.5]5.1 [4.6–5.6]
Dirofilaria immitis12.8 [12.0–13.6]3.8 [3.5–4.1]
Trichuris callipaeda17.4 [15.9–19.0]4.9 [4.2–5.6]
  • Nicotine preference: All ACR-16 receptors show higher affinity for nicotine than acetylcholine .

  • Anthelmintic targets: Trichuris suis ACR-16-like receptors are highly sensitive to oxantel (EC₅₀ = 0.5 μM), a narrow-spectrum anthelmintic .

Evolutionary Insights

ACR-16 has diverged across nematode clades:

  • Clade III progression: Maximal current responses decline from basal (A. suum: 2,052 nA) to derived species (B. malayi: 0 nA) .

  • Accessory protein reliance: Later clade species require additional ER chaperones (e.g., EMC-6) due to evolutionary changes in subunit assembly .

  • Functional conservation: Despite structural divergence, ACR-16 retains its role as the primary non-levamisole-sensitive nAChR across nematodes .

Applications in Anthelmintic Research

  • Drug target validation: ACR-16 is a key target for oxantel and other cholinergic anthelmintics .

  • Resistance mechanisms: Reduced expression efficiency (e.g., in B. malayi) may correlate with drug resistance .

  • Chimeric studies: Swapping ICL regions between species enhances current responses, aiding pharmacological profiling .

Challenges and Future Directions

  • Expression optimization: Derived species require complex accessory protein combinations for functional reconstitution .

  • Structural studies: Cryo-EM of ACR-16 homopentamers could reveal drug-binding pockets .

  • Species-specific drug design: Targeting ACR-16 variations in parasitic nematodes may improve anthelmintic specificity .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate special format requests. Please indicate your preference in the order notes and we will do our best to fulfill it.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery information.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional charges may apply.
Notes
Repeated freezing and thawing should be avoided. Working aliquots can be stored at 4°C for up to one week.
Reconstitution
To ensure proper reconstitution, we recommend briefly centrifuging the vial before opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard final concentration of glycerol is 50% and can serve as a reference point.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life for liquid forms is 6 months at -20°C/-80°C. For lyophilized forms, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple use. Repeated freeze-thaw cycles should be minimized.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag preference, please inform us and we will prioritize its development.
Synonyms
acr-16; CBG01491; Acetylcholine receptor subunit alpha-type acr-16
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
20-499
Protein Length
Full Length of Mature Protein
Species
Caenorhabditis briggsae
Target Names
acr-16
Target Protein Sequence
SLQERRLYEDLMRNYNNLERPVANHSEPVTVHLKVALQQIIDVDEKNQVVYVNAWLDYTW KDYNLVWDQAEYGNITDVRFPAGKIWKPDVLLYNSVDTNFDSTYQTNMIVYSSGLVHWVP PGIFKISCKIDIQWFPFDEQKCFFKFGSWTYDGYKLDLQPATGGFDISEYLPNGEWALPL TTVERNEKFYDCCPEPYPDVHFYLHMRRRTLYYGFNLIMPCILTTLMTLLGFTLPPDAGE KITLQITVLLSICFFLSIVSEMSPPTSEAVPLLGIFFTCCMIVVTASTVFTVYVLNLHYR TPETHDMGPWTRNLLLYWIPWILRMKRPGHNLTYASLPSLFASKPNRHSESLIRNIKDNE HSLSRANSFDADCRLNQYIMTQSVSNGLTSMGSIPSTMISSTNGALTDVSQQATLLILHR IYHELKIVTKRMIEGDKEEQASNNWKFAAMVVDRLCLYVFTIFIIASTIGIFWSAPYLVA
Uniprot No.

Target Background

Function
Upon binding acetylcholine, the AChR undergoes a significant conformational change affecting all subunits. This change results in the opening of an ion-conducting channel across the plasma membrane. The A subunit is part of the levamisole-insensitive nicotinic receptor.
Database Links

STRING: 6238.CBG01491

Protein Families
Ligand-gated ion channel (TC 1.A.9) family, Acetylcholine receptor (TC 1.A.9.1) subfamily
Subcellular Location
Cell junction, synapse, postsynaptic cell membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein.

Q&A

What is Acetylcholine Receptor Subunit Alpha-type ACR-16 and what is its significance in nematode research?

ACR-16 is a homopentameric nicotine-sensitive acetylcholine receptor (N-AChR) found across multiple nematode species. This receptor plays a critical role in neurotransmission and has emerged as an important target for anthelmintic drug development. The significance of ACR-16 lies in its evolutionary conservation across nematodes while exhibiting species-specific functional characteristics. ACR-16 has been successfully reconstituted and characterized from several different nematode species, making it valuable for comparative neurophysiological studies .

Research demonstrates that ACR-16 forms functional homopentameric receptors that respond to both acetylcholine and nicotine. The receptor is particularly notable for its consistent conservation across evolutionary diverse nematode species from clade III (including parasitic species like Ascaris suum) to clade V (including model organisms like Caenorhabditis elegans) .

How is ACR-16 conserved across different nematode species?

ACR-16 shows remarkable conservation across the nematode phylum while exhibiting distinctive functional variations between species. Genomic analysis confirms that the acr-16 gene is present across diverse nematode lineages, including both free-living and parasitic species. The structural elements necessary for channel function and ligand binding remain conserved, as evidenced by the consistent response to acetylcholine and nicotine across species .

Despite this conservation, functional studies reveal progressive changes in ACR-16 properties along evolutionary lines. For example, in clade III nematodes, a graduated decrease in receptor response has been documented from Ascaris suum through Dracunculus medinensis, Gonglylonema pulchrum, and Thelazia callipaeda to Brugia malayi. This suggests that while the core receptor structure remains conserved, regulatory mechanisms governing receptor assembly, trafficking, or function have evolved differently across species .

What methodological approaches are most effective for reconstituting functional ACR-16 receptors?

The gold standard for ACR-16 functional reconstitution involves heterologous expression in Xenopus laevis oocytes, which provides an excellent system for electrophysiological characterization. This methodology requires:

  • cRNA synthesis of the target acr-16 gene from the species of interest

  • Co-expression with appropriate accessory proteins, particularly RIC-3

  • Microinjection into defolliculated Xenopus oocytes

  • Incubation period (typically 3-5 days) for receptor expression

  • Two-electrode voltage clamp electrophysiology for functional assessment

For successful reconstitution, especially with challenging species like Brugia malayi, additional accessory proteins may be necessary. Research has demonstrated that EMC-6, NRA-2, and NRA-4 are required for functional reconstitution of B. malayi ACR-16, whereas other species may require only RIC-3 .

SpeciesRequired Accessory ProteinsIncubation PeriodTypical Response Amplitude (ACh)
A. suumRIC-33-4 days2052 ± 66 nA
D. medinensisRIC-33-4 days2150 ± 59 nA
G. pulchrumRIC-33-4 days1401 ± 91 nA
T. callipaedaRIC-33-4 days563 ± 39 nA
B. malayiRIC-3 + EMC-6 + NRA-2 + NRA-43-5 daysMeasurable only with additional accessory proteins

How should researchers interpret differences in ACR-16 response magnitude across species?

The interpretation of differential ACR-16 response magnitudes requires careful consideration of multiple factors:

  • Evolutionary context: The progressive decline in ACR-16 current response observed along the phylogenetic progression from A. suum to B. malayi suggests an evolutionary trend rather than a discrete event. This decline correlates with the phylogenetic relationships between these species .

  • Accessory protein requirements: Lower responses may indicate increased dependency on specific accessory proteins. For example, B. malayi ACR-16 requires additional accessory proteins beyond RIC-3, suggesting evolution of more complex receptor assembly mechanisms .

  • Experimental artifacts: When analyzing response differences, researchers should control for potential artifacts from the expression system. For instance, endogenous calcium-gated chloride channels in oocytes can alter current responses. Studies have examined this using calcium chelators like BAPTA-AM, though this approach may compromise oocyte quality .

  • Response kinetics: Beyond maximum amplitude, the time course of the response should be analyzed. Species showing lower maximum responses often also demonstrate slower response kinetics, suggesting differences in channel gating properties or receptor trafficking to the cell surface .

What do concentration-response relationships reveal about ACR-16 pharmacology across nematode species?

Concentration-response analyses provide critical insights into ACR-16 pharmacological properties across species. Despite differences in maximum response amplitude, the pharmacological profiles remain relatively consistent:

For acetylcholine (ACh):

  • A. suum ACR-16: EC50 = 8.9 μM, 95% CI [8.2, 9.5]

  • D. medinensis ACR-16: EC50 = 12.8 μM, 95% CI [12.0, 13.6]

  • G. pulchrum ACR-16: EC50 = 10.5 μM, 95% CI [9.6, 11.4]

  • T. callipaeda ACR-16: EC50 = 17.4 μM, 95% CI [15.9, 19.0]

For nicotine (NIC):

  • A. suum ACR-16: EC50 = 5.1 μM, 95% CI [4.6, 5.6]

  • D. medinensis ACR-16: EC50 = 3.8 μM, 95% CI [3.5, 4.1]

  • G. pulchrum ACR-16: EC50 = 2.1 μM, 95% CI [1.9, 2.3]

  • T. callipaeda ACR-16: EC50 = 4.9 μM, 95% CI [4.2, 5.6]

These data reveal that:

  • ACR-16 consistently shows higher affinity for nicotine than acetylcholine across all species studied

  • While maximum response magnitudes differ dramatically across species, EC50 values remain within a relatively narrow range

  • The pharmacological profile is largely preserved despite evolutionary divergence

This conservation of pharmacological properties despite variations in expression efficiency suggests the core ligand binding and channel activation mechanisms remain intact across species, while regulatory mechanisms for receptor assembly or trafficking have evolved .

How can researchers overcome challenges in reconstituting functional ACR-16 from Brugia malayi?

The reconstitution of B. malayi ACR-16 presents unique challenges that require specific methodological approaches:

How should researchers design experiments to compare ACR-16 function across evolutionary distant nematode species?

Effective comparative studies of ACR-16 across nematode species require careful experimental design:

  • Phylogenetic sampling strategy: Select species that represent distinct evolutionary branches. The approach used in studying the progression from A. suum through intermediate species to B. malayi provided valuable insights by including representatives across the clade III phylogeny .

  • Standardized expression conditions:

    • Use identical amounts of cRNA for each species

    • Maintain consistent incubation conditions

    • Express receptors in oocytes from the same batch to minimize variability

  • Parallel controls: Always include a well-characterized ACR-16 (such as from A. suum) as a positive control in each experiment to account for batch-to-batch variability in oocyte quality .

  • Comprehensive pharmacological profiling: Test multiple agonists (acetylcholine, nicotine, and other cholinergic compounds) to develop complete pharmacological profiles .

  • Time-course studies: Measure responses at multiple time points post-injection to account for potential differences in expression kinetics.

  • Multiple accessory protein combinations: Test each ACR-16 with different combinations of accessory proteins to identify optimal reconstitution conditions and reveal species-specific requirements .

What data analysis approaches help resolve contradictions in ACR-16 research findings?

When analyzing potentially contradictory ACR-16 research findings, consider these methodological approaches:

  • Normalize data appropriately: When comparing across studies or species, normalize responses to a standard reference (e.g., maximum ACh response in A. suum) to account for differences in expression efficiency .

  • Statistical analysis of concentration-response data:

    • Use non-linear regression to generate complete concentration-response curves

    • Compare EC50 values and their confidence intervals to assess statistical significance of differences

    • Evaluate Hill coefficients to identify potential differences in cooperativity

  • Consider multiple parameters: Beyond maximum response and EC50, analyze:

    • Response onset and decay kinetics

    • Receptor desensitization characteristics

    • Recovery from desensitization

    • Responses to multiple agonists and antagonists

  • Meta-analysis approaches: When confronted with conflicting results across studies:

    • Create data tables comparing methodological differences between studies

    • Assess the impact of different expression systems or accessory proteins

    • Consider phylogenetic relationships when interpreting differences

  • Multi-way data table analysis: Using approaches similar to those described for RDAS (Research Data Access System), create multi-dimensional analyses that incorporate variables such as:

    • Species

    • Accessory proteins used

    • Expression time

    • Agonist concentration

How might ACR-16 research inform anthelmintic drug development strategies?

ACR-16 research offers several promising avenues for anthelmintic drug development:

  • Species-specific targeting: The observed differences in ACR-16 properties across nematode species suggest possibilities for developing compounds that selectively target parasitic species while sparing beneficial or non-target organisms .

  • Accessory protein targeting: The differential requirements for accessory proteins (particularly in B. malayi) suggest these proteins could serve as novel drug targets, potentially disrupting receptor assembly rather than function .

  • Evolutionary approach to resistance mechanisms: Studying the evolutionary changes in ACR-16 across nematode phylogeny may reveal natural variations that confer resistance to certain compounds, helping predict and counter potential resistance mechanisms .

  • Structure-function relationships: Detailed pharmacological characterization across species provides insights into critical binding domains that could be targeted with higher specificity.

  • Reconstitution systems as screening platforms: The established oocyte expression systems for various nematode ACR-16 receptors provide excellent platforms for screening candidate compounds .

What methodological innovations might improve ACR-16 functional characterization?

Several methodological approaches could enhance ACR-16 research:

  • Cryo-EM structural analysis: Structural determination of ACR-16 from different species would provide unprecedented insights into species-specific differences and guide structure-based drug design.

  • Advanced genetic approaches: CRISPR-based modification of accessory proteins in native nematodes could help validate their roles in vivo.

  • High-throughput electrophysiology: Automated patch-clamp systems adapted for oocytes could accelerate pharmacological profiling.

  • Fluorescent trafficking studies: Tagging ACR-16 with fluorescent markers could help visualize trafficking differences between species and quantify surface expression.

  • Single-molecule imaging: Super-resolution microscopy of labeled ACR-16 receptors could reveal differences in clustering, mobility, or interactions with other proteins.

  • Computational modeling: Molecular dynamics simulations based on homology models could predict species-specific responses to novel compounds.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.