Recombinant Acheta domesticus Cytochrome c oxidase subunit 2 (COII)

Shipped with Ice Packs
In Stock

Description

Function and Structure of COII

COII is one of the three mitochondrial DNA-encoded subunits of cytochrome c oxidase, along with COI and COIII . It contains two adjacent transmembrane regions at its N-terminus and is primarily exposed to the intermembrane space of the mitochondria. The binuclear copper A center in COII is essential for the initial electron transfer from cytochrome c to the enzyme complex .

Recombinant Proteins

Recombinant proteins are produced through genetic engineering techniques where a gene from one organism is inserted into another organism's genome, allowing the host to express the desired protein. This technology is widely used in biotechnology for producing therapeutic proteins, vaccines, and enzymes. In the context of Acheta domesticus, recombinant proteins could potentially be used to enhance nutritional or pharmaceutical applications, but specific research on recombinant COII from this species is lacking.

Research Findings and Potential Applications

While there is no direct research on recombinant Acheta domesticus COII, understanding the role of COII in the electron transport chain can provide insights into how modifications or recombinant versions might impact energy metabolism in insects. This could have implications for biotechnological applications, such as enhancing insect growth rates or improving their nutritional content.

Table: Comparison of Insect Species for Nutritional and Biotechnological Applications

SpeciesNutritional ContentBiotechnological Applications
Acheta domesticusHigh protein, linoleic acidPotential for recombinant protein production
Gryllus bimaculatusLower lipid contentTherapeutic protein production
Tenebrio molitorSimilar lipid profile to A. domesticusBiodegradable plastic production

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, offered as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
COII; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-227
Protein Length
full length protein
Species
Acheta domesticus (House cricket)
Target Names
COII
Target Protein Sequence
MATWSNLNLQNSSSPLMEQLIFFHDHTLMILLMITVLVAYIMSMLFFNLYTNRFLLEGQT IEIIWTILPAITLIFIALPSLRLLYLLDESMDPLITMKTIGHQWYWSYEYMDFKNIIEFD SYMSALDKLSSFRLLDVDNRTILPMNTQIRTLVTAADVIHSWTVSALGVKTDATPGRLNQ INFMINRPGLFYGQCSEICGANHSFMPIVIESVNLKNFINWIKNYSS
Uniprot No.

Target Background

Function
Cytochrome c oxidase subunit 2 (COII) is a component of cytochrome c oxidase (complex IV, CIV), the terminal enzyme in the mitochondrial electron transport chain. This enzyme complex plays a critical role in oxidative phosphorylation. The respiratory chain comprises three multi-subunit complexes: succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (complex III, CIII), and cytochrome c oxidase (complex IV, CIV). These complexes work in concert to transfer electrons from NADH and succinate to molecular oxygen, establishing an electrochemical gradient across the inner mitochondrial membrane that drives ATP synthesis and transmembrane transport. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c in the intermembrane space are transferred through the CuA center of subunit 2 and heme A of subunit 1 to the binuclear center (BNC) in subunit 1, comprised of heme A3 and CuB. The BNC reduces molecular oxygen to water using four electrons from cytochrome c and four protons from the mitochondrial matrix.
Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Cytochrome c oxidase subunit 2 in Acheta domesticus?

Cytochrome c oxidase subunit 2 (COII) in Acheta domesticus (house cricket) is a highly conserved protein component of the cytochrome c oxidase complex. It functions as a critical enzyme in the electron transport chain, specifically responsible for the initial transfer of electrons from cytochrome c to cytochrome c oxidase. This process is essential for ATP production during cellular respiration. The full-length protein consists of 227 amino acids and has the UniProt accession number P29870 . The protein's primary role in energy metabolism makes it a significant target for diverse research applications in evolutionary biology, molecular genetics, and biomarker development.

How does COII structure relate to its function in cellular respiration?

The structure of COII directly correlates with its critical function in cellular respiration. As a component of complex IV in the electron transport chain, COII contains specialized domains that facilitate electron transfer from cytochrome c to the catalytic center of the enzyme. The protein contains highly conserved regions that form binding sites for both cytochrome c and other subunits of the cytochrome c oxidase complex.

Analysis of the primary structure reveals several key functional regions:

  • Transmembrane helices that anchor the protein in the mitochondrial membrane

  • Hydrophilic domains exposed to the intermembrane space that interact with cytochrome c

  • Metal-binding sites (particularly copper) that participate directly in electron transfer

  • Interface regions that interact with other subunits of the cytochrome c oxidase complex

These structural features enable COII to effectively channel electrons during oxidative phosphorylation, making it essential for energy production in the house cricket .

What are the optimal conditions for recombinant expression of Acheta domesticus COII?

For optimal recombinant expression of Acheta domesticus COII, researchers should consider the following protocol parameters:

Expression System Selection:

  • Bacterial systems (E. coli BL21(DE3)) are suitable for basic structural studies

  • Insect cell lines (Sf9, Sf21) provide superior post-translational modifications

  • HEK293 mammalian cells may be used when proper folding is critical

Expression Optimization Parameters:

  • Induction temperature: 16-18°C for E. coli systems to minimize inclusion body formation

  • IPTG concentration: 0.1-0.5 mM for bacterial systems

  • Incubation time: 16-24 hours post-induction for optimal yield

  • Media supplements: Addition of heme precursors and trace metals (copper) to support proper folding

Purification Strategy:

  • Initial capture: Immobilized metal affinity chromatography (IMAC) using His-tag

  • Secondary purification: Size exclusion chromatography to remove aggregates

  • Buffer composition: Tris-based buffer with 50% glycerol for stability

The recombinant protein should be stored at -20°C for regular use, or at -80°C for extended storage to maintain functionality. Repeated freeze-thaw cycles should be avoided, with working aliquots kept at 4°C for up to one week .

How can researchers design specific primers for COII amplification from Acheta domesticus samples?

Designing specific primers for COII amplification from Acheta domesticus requires careful consideration of sequence conservation, specificity, and amplification efficiency. Based on established protocols for similar mitochondrial genes, researchers should follow these methodological steps:

  • Sequence Analysis and Target Region Selection:

    • Compare the known COII sequence (Uniprot P29870) with related species to identify unique regions

    • Select regions with 40-60% GC content for optimal primer binding

    • Target unique regions while avoiding highly variable sections to ensure specificity

  • Primer Design Parameters:

    • Design primers 18-25 nucleotides in length

    • Ensure melting temperatures (Tm) between 55-65°C with <5°C difference between primer pairs

    • Avoid secondary structures and primer-dimers using software prediction tools

    • Include GC clamp (2-3 G or C nucleotides) at the 3' end for efficient extension

  • Specificity Verification:

    • Perform BLAST analysis to confirm primer specificity to Acheta domesticus

    • Check for cross-reactivity with closely related cricket species

This approach parallels successful primer design strategies used in the development of real-time PCR protocols for house cricket detection, where researchers achieved high specificity targeting the cytochrome oxidase gene region . For COII specifically, researchers should target a 90-120 bp amplicon within the coding region for optimal qPCR performance.

What detection methods are most sensitive for quantifying COII expression in Acheta domesticus tissues?

For maximum sensitivity in quantifying COII expression in Acheta domesticus tissues, researchers should implement a comprehensive approach combining multiple techniques:

Real-time Quantitative PCR (RT-qPCR):

  • Limit of detection: Can detect as low as 1 genome copy (approximately 2.14 pg of DNA)

  • Reference gene selection: Use stable reference genes such as EF1α, RPL32, or Hsp70 for normalization based on developmental stage

  • Consider efficiency correction methods to account for variations in amplification efficiency

  • Implement absolute quantification using standard curves from recombinant plasmids

Western Blot with Enhanced Chemiluminescence:

  • Sensitivity can be increased using signal amplification systems

  • Optimize protein extraction protocols specifically for mitochondrial proteins

  • Use mild detergents to maintain protein structure during extraction

ELISA-Based Detection:

  • Commercial recombinant COII protein can serve as standards for calibration curves

  • Sandwich ELISA formats offer superior sensitivity (detection limits in pg/mL range)

  • Optimize antibody concentrations and blocking buffers for cricket tissue matrices

Mass Spectrometry:

  • Targeted proteomics approaches (MRM/PRM) offer highest specificity

  • Utilize unique peptide signatures from the known amino acid sequence

  • Implement isotopically labeled standards for absolute quantification

For most research applications, RT-qPCR provides the optimal balance of sensitivity, specificity, and throughput, with a detection limit of approximately 2.14 pg DNA when properly optimized .

How does Acheta domesticus COII compare with homologs in other insect species?

Acheta domesticus COII shows varying degrees of conservation when compared with homologs in other insect species, reflecting both functional constraints and evolutionary divergence. Comparative analysis reveals:

Sequence Conservation Patterns:

Species GroupAverage Sequence IdentityConserved Functional DomainsVariable Regions
Other Orthoptera75-85%Metal binding sites, Cytochrome c interaction domainsN-terminal region, Surface loops
Lepidoptera60-70%Core catalytic residuesTransmembrane regions, Species-specific insertions
Diptera55-65%Electron transfer pathwayTerminal domains, Surface-exposed regions
Coleoptera50-60%Structural core elementsVariable loops, Terminal extensions

Functional Implications:

  • Despite sequence divergence, the core functional domains responsible for electron transfer remain highly conserved across insect orders

  • Species-specific variations occur primarily in regions not directly involved in catalytic function

  • Transmembrane domains show higher variability while maintaining hydrophobicity profiles

  • Metal-binding sites exhibit the highest conservation, reflecting their critical role in enzyme function

These patterns of conservation and divergence provide valuable insights into the evolutionary constraints on COII and can inform experimental design when working across species boundaries. The observed divergence patterns are consistent with studies on other cytochrome c oxidase subunits that demonstrate strong purifying selection on functionally critical regions .

What evolutionary pressures have shaped COII sequence variation in cricket species?

The evolutionary trajectory of COII in cricket species reflects a complex interplay of selective pressures that have shaped sequence variation across evolutionary time. Several key evolutionary mechanisms have been identified:

Purifying Selection:
Most codons in the COII gene are under strong purifying selection (ω << 1), reflecting functional constraints on this critical metabolic enzyme. This pattern parallels findings in other organisms where the majority of COII sites experience negative selection to maintain core functionality .

Positive Selection:
Approximately 4% of sites in COII may evolve under relaxed selective constraint (ω = 1), primarily in regions that interact with nuclear-encoded subunits of the cytochrome c oxidase complex. These sites likely undergo compensatory evolution to maintain optimal protein-protein interactions despite genetic drift in interacting partners .

Coevolution with Nuclear Genome:
The mitochondrial COII gene must maintain functional compatibility with nuclear-encoded components of the respiratory chain. This mitonuclear coevolution creates selection pressure for compensatory mutations when populations become isolated, potentially contributing to speciation barriers .

Environmental Adaptation:
Selection on COII may reflect adaptation to different thermal environments, as cytochrome c oxidase function is temperature-sensitive. Populations adapted to different climatic regimes may show fixed differences in COII sequences that optimize function under local conditions.

These evolutionary patterns make COII a valuable marker for phylogenetic studies in crickets and provide insights into the molecular basis of adaptation to different environments.

Can COII sequences be used for species identification and population genetics in Acheta domesticus?

COII sequences offer robust utility for both species identification and population genetic analyses in Acheta domesticus and related cricket species, though with important methodological considerations:

Species Identification Applications:
COII sequences provide reliable barcode data for species-level identification, similar to COI but with some distinct advantages. While COI is more commonly used for DNA barcoding, COII offers complementary information that can resolve ambiguous cases. The high interspecific variation combined with low intraspecific divergence creates effective "barcode gaps" that enable accurate species assignment .

Population Genetics Applications:
At the population level, COII sequences can reveal:

  • Historical population expansions and contractions

  • Gene flow patterns between geographically separated populations

  • Signatures of selection across environmental gradients

  • Cryptic diversity within morphologically similar populations

Methodological Considerations:
When using COII for these applications, researchers should:

  • Amplify consistent regions across all samples to ensure comparability

  • Implement appropriate evolutionary models that account for the high AT bias in insect mitochondrial genes

  • Consider the maternal inheritance pattern of mitochondrial DNA when interpreting population structure

  • Complement COII data with nuclear markers to detect hybridization or introgression

A combined approach using both COII and nuclear markers provides the most comprehensive assessment of population structure and evolutionary history in cricket species, allowing researchers to distinguish between selection-driven divergence and neutral demographic processes.

How can recombinant COII be utilized in structural biology studies?

Recombinant Acheta domesticus COII provides a valuable tool for detailed structural biology investigations, offering insights into both basic protein structure and complex assemblies. Researchers can implement the following methodological approaches:

X-ray Crystallography:

  • Expression optimization: Utilize insect cell lines for proper folding and post-translational modifications

  • Construct design: Create fusion proteins with crystallization chaperones to enhance crystal formation

  • Purification: Implement multi-step chromatography to achieve >95% purity required for crystallization

  • Crystallization screening: Explore factorial designs of precipitants, pH values, and additives

Cryo-Electron Microscopy:

  • Sample preparation: Optimize vitrification conditions for recombinant COII complexes

  • Grid preparation: Use different surface treatments to encourage varied particle orientations

  • Data collection: Implement beam-induced motion correction for high-resolution imaging

  • Classification approaches: Utilize 3D classification to identify conformational states

NMR Spectroscopy for Dynamic Studies:

  • Isotopic labeling: Express COII in media containing 15N and 13C for multidimensional NMR studies

  • Fragment-based approaches: Study key domains separately if full-length protein proves challenging

  • Focus on metal-binding sites: Investigate the copper-binding domains critical for function

  • Ligand interaction studies: Map cytochrome c binding interfaces through chemical shift perturbation

The structural data generated through these approaches can inform rational design of site-directed mutagenesis experiments to probe structure-function relationships and potentially develop tools to modulate COII activity in research applications.

What role does COII play in adaptive responses to environmental stressors in Acheta domesticus?

COII plays a multifaceted role in adaptive responses to environmental stressors in Acheta domesticus, serving as both a functional adaptation target and a marker of mitochondrial performance under stress conditions:

Thermal Stress Responses:
COII expression and activity show temperature-dependent modulation that correlates with the cricket's thermal tolerance limits. Under high-temperature stress, COII expression patterns shift to maintain ATP production despite increased metabolic demands. These changes may involve both transcriptional regulation and post-translational modifications that optimize enzyme function at elevated temperatures.

Hypoxia Adaptation:
During oxygen limitation, COII regulation becomes critical for maintaining energy production. Research indicates that:

  • Short-term hypoxia may trigger compensatory upregulation of COII to maximize oxygen utilization

  • Prolonged hypoxia can lead to restructuring of respiratory complexes

  • Cricket populations from different habitats may show fixed genetic differences in COII that reflect local oxygen regimes

Oxidative Stress Management:
As a component of the electron transport chain, COII is at the frontline of reactive oxygen species (ROS) production. Adaptive modifications to COII structure or regulation can minimize electron leakage and subsequent ROS generation during environmental stress.

Methodological Approaches for Investigation:
Researchers can study these adaptive responses using:

  • Controlled environmental chambers to impose precise stressor regimes

  • Real-time monitoring of respiratory parameters using respirometry

  • Combined transcriptomic and proteomic analyses to identify regulatory networks

  • Comparative studies across populations from different environmental conditions

Understanding these adaptive mechanisms provides insights into both evolutionary processes and potential biotechnological applications related to stress resistance in insects.

How can COII be used as a biomarker in ecotoxicological studies involving crickets?

COII offers significant potential as a biomarker in ecotoxicological studies involving crickets, providing multiple measurement endpoints that reflect the impact of environmental contaminants on mitochondrial function and energy metabolism:

Molecular Biomarker Applications:

  • Expression Level Changes: Quantitative PCR analysis of COII transcript levels can detect sublethal stress responses to toxicants that affect mitochondrial function. The PCR protocols can be adapted from those developed for species identification, with a limit of detection as low as 1 genome copy .

  • Protein Abundance Shifts: Western blot or ELISA techniques using recombinant COII as a standard can quantify changes in protein levels following toxicant exposure .

  • Post-translational Modifications: Mass spectrometry approaches can identify oxidative modifications or other PTMs that reflect toxicant-induced stress.

  • Sequence Variations: Populations chronically exposed to contaminants may exhibit adaptive mutations in COII that can be detected through sequencing.

Functional Biomarker Applications:

  • Enzyme Activity Assays: Cytochrome c oxidase activity measurements provide direct assessment of functional impairment.

  • ROS Production: Since COII is involved in electron transport, dysfunction can lead to increased ROS, measurable through fluorescent probes.

  • ATP Production Capacity: Functional impairment of COII directly impacts ATP synthesis, which can be quantified as an integrated endpoint.

Experimental Design Considerations:

Exposure TypeRecommended BiomarkersSampling TimelineControl Measures
Acute ToxicityEnzyme activity, ROS production24-96 hoursAge-matched controls, Reference toxicants
Chronic ExposureExpression levels, Sequence variation7-28 daysMultiple reference genes, Population controls
Mixture EffectsIntegrated biomarker responsesMultiple timepointsFactorial designs, Individual compound controls

These applications make COII a valuable biomarker for environmental monitoring and ecological risk assessment using house crickets as test organisms.

What are common challenges in recombinant COII expression and how can they be addressed?

Researchers frequently encounter several challenges when expressing recombinant Acheta domesticus COII. Below are systematic approaches to overcome these issues:

Challenge 1: Poor Expression Yield

  • Root Causes: Codon bias, protein toxicity, improper induction conditions

  • Solutions:

    • Optimize codon usage for the expression host

    • Use tightly regulated promoters to control expression

    • Reduce induction temperature to 16-18°C

    • Co-express molecular chaperones (e.g., GroEL/GroES) to aid folding

    • Test different fusion tags beyond standard His-tag (MBP, SUMO) to enhance solubility

Challenge 2: Protein Misfolding and Aggregation

  • Root Causes: Improper disulfide bond formation, absence of post-translational modifications, hydrophobic regions

  • Solutions:

    • Express in eukaryotic systems for proper post-translational modifications

    • Include copper ions in growth media to facilitate metal binding

    • Add mild detergents during purification to stabilize hydrophobic regions

    • Implement on-column refolding protocols during purification

Challenge 3: Loss of Activity During Purification

  • Root Causes: Oxidation of critical residues, metal loss, improper buffer conditions

  • Solutions:

    • Include reducing agents (e.g., 1-2 mM DTT) in all buffers

    • Supplement buffers with copper ions to maintain metalloprotein integrity

    • Optimize buffer pH and ionic strength through factorial screening

    • Add glycerol (50%) to final storage buffer to enhance stability

Challenge 4: Verification of Proper Folding

  • Root Causes: Lack of suitable assays, complex nature of the protein

  • Solutions:

    • Develop spectroscopic assays targeting the heme absorption spectrum

    • Perform thermal shift assays to assess structural stability

    • Use limited proteolysis to confirm compact folding

    • Implement electron transfer activity assays with cytochrome c

Implementing these troubleshooting strategies systematically can significantly improve recombinant COII quality and yield for research applications.

How should researchers optimize PCR conditions for COII amplification from different cricket tissue samples?

Optimizing PCR conditions for COII amplification from cricket tissue samples requires systematic adjustment of multiple parameters to overcome tissue-specific challenges while maintaining specificity and sensitivity:

Tissue-Specific Extraction Protocols:

Tissue TypeRecommended Extraction MethodSpecial ConsiderationsExpected Yield
MuscleStandard phenol-chloroformHigh mitochondrial content provides excellent yields50-100 ng/μL
ReproductiveModified CTAB methodIncreased lipid content requires additional cleaning steps20-50 ng/μL
HemolymphDirect PCR buffersLimited sample volume requires minimal processing5-15 ng/μL
GutInhibitor removal kitsPresence of food-derived PCR inhibitors10-30 ng/μL

PCR Optimization Strategy:

  • Template Quality Assessment:

    • Perform spectrophotometric analysis (A260/A280, A260/A230) to detect contaminants

    • Use control gene amplification (e.g., 18S rRNA) to verify template quality

    • Consider nested PCR approach for degraded samples

  • PCR Component Optimization:

    • Magnesium concentration: Test range from 1.5-4.0 mM

    • Template amount: Adjust based on tissue type (0.5-5 μL of extract)

    • Enzyme selection: Use high-fidelity polymerases for downstream applications requiring accuracy

    • BSA addition (0.1-0.5 μg/μL) to overcome inhibitors in gut samples

  • Thermal Cycling Parameters:

    • Optimize annealing temperature through gradient PCR (typical range: 52-62°C)

    • Extend elongation time for longer amplicons (1 minute per kb)

    • Implement touchdown PCR protocol for difficult templates

    • Consider hot-start techniques to improve specificity

This methodical approach parallels successful PCR protocol development for other insect mitochondrial genes, where sensitivity down to 1 genome copy (2.14 pg DNA) has been achieved through careful optimization .

What are the critical factors to consider when analyzing COII sequence data for phylogenetic studies?

When analyzing COII sequence data for phylogenetic studies, researchers must address several critical methodological considerations to ensure robust and biologically meaningful results:

Sequence Quality Control:

  • Implement bidirectional sequencing to verify accuracy

  • Check chromatograms for signal quality and mixed bases

  • Verify absence of nuclear mitochondrial pseudogenes (NUMTs) through:

    • Examination of unexpected indels

    • Absence of stop codons in the reading frame

    • Comparison with verified reference sequences

    • Phylogenetic placement consistency

Alignment Considerations:

  • Use codon-aware alignment algorithms for protein-coding sequences

  • Manually verify automatic alignments, especially in length-variable regions

  • Consider translation-based alignment to maintain reading frame

  • Evaluate the impact of gap treatment on phylogenetic inference

Model Selection:

  • Test multiple evolutionary models using information criteria (AIC, BIC)

  • Account for codon position heterogeneity through partitioned models

  • Consider amino acid translation for deep divergences to reduce saturation effects

  • Implement site-heterogeneous models for datasets with compositional heterogeneity

Tree Construction Methods:

  • Compare results from multiple approaches (ML, Bayesian, MP, NJ)

  • Assess node support through bootstrapping or posterior probabilities

  • Implement appropriate outgroup selection based on established phylogenies

  • Consider molecular clock analyses for divergence time estimation

Interpretation Caveats:

  • Recognize the limitations of single-gene phylogenies

  • Address potential discordance between mitochondrial and nuclear gene trees

  • Consider the impact of incomplete lineage sorting on shallow divergences

  • Evaluate the possibility of mitochondrial introgression in closely related species

By addressing these factors systematically, researchers can maximize the phylogenetic information contained in COII sequences while minimizing methodological artifacts that could lead to incorrect evolutionary inferences .

How might CRISPR-Cas9 be utilized to study COII function in Acheta domesticus?

CRISPR-Cas9 technology offers unprecedented opportunities to investigate COII function in Acheta domesticus through precise genetic manipulation. The following methodological approach outlines how researchers can implement this technology:

Technical Implementation Strategy:

  • Guide RNA Design:

    • Target conserved functional domains identified from sequence analysis

    • Design multiple gRNAs to increase editing efficiency

    • Implement in silico off-target prediction to minimize non-specific effects

    • Focus on regions with minimal genetic variation within the species

  • Delivery Method Optimization:

    • Microinjection into embryos at early developmental stages

    • Lipofection for cultured cricket cell lines

    • Electroporation for tissue-specific studies in adult crickets

    • Viral vector delivery for systemic expression

  • Editing Approach Selection:

    • Knockout studies: Introduce frameshift mutations or early stop codons

    • Knock-in strategies: Insert reporter genes (GFP) for localization studies

    • Base editing: Create specific amino acid substitutions in functional domains

    • Prime editing: Make precise modifications with minimal off-target effects

Experimental Applications:

  • Structure-Function Analysis: Systematically mutate key residues in electron transfer pathways

  • Regulatory Studies: Modify promoter elements to study transcriptional regulation

  • Developmental Research: Create conditional knockouts to examine stage-specific requirements

  • Environmental Adaptation: Engineer variants found in different populations to test fitness effects

Expected Challenges and Solutions:

  • Fitness Impacts: Use inducible systems to bypass developmental lethality

  • Off-Target Effects: Implement high-fidelity Cas9 variants and thorough validation

  • Mosaicism: Screen multiple generations to establish stable lines

  • Functional Validation: Develop comprehensive phenotyping protocols specifically for mitochondrial function

This CRISPR-based approach would significantly advance our understanding of COII biology beyond what can be achieved through observational or correlative studies alone.

What potential applications exist for recombinant COII in biodiversity monitoring and conservation?

Recombinant Acheta domesticus COII offers innovative applications for biodiversity monitoring and conservation efforts, particularly as environmental DNA (eDNA) and metabarcoding approaches become more prevalent:

Reference Standards for Metabarcoding:
Recombinant COII can serve as positive controls and calibration standards for metabarcoding studies targeting Orthopteran diversity. This application provides:

  • Absolute quantification capability for abundance estimation

  • Quality control metrics for primer efficiency

  • Detection limit determination across different environmental matrices

  • Internal standards to normalize sequencing bias

Biodiversity Assessment Tools:

  • Custom Microarrays: Develop hybridization arrays using COII sequence variation to rapidly screen environmental samples for cricket diversity

  • Species-Specific qPCR Assays: Design primer/probe sets for endangered cricket species monitoring

  • Portable Sequencing Applications: Create field-deployable protocols for real-time biodiversity assessment

Conservation Applications:

  • Population Genetic Monitoring: Develop non-invasive sampling methods targeting COII in environmental samples

  • Reintroduction Program Support: Genetic screening of captive breeding populations for mitochondrial diversity

  • Habitat Fragmentation Assessment: Track gene flow patterns using COII as a marker across landscape barriers

  • Climate Change Response Monitoring: Track range shifts and adaptive responses through COII variant tracking

Methodological Framework:

  • Express and purify recombinant COII variants representing known haplotype diversity

  • Develop standardized protocols for environmental sample processing

  • Implement multiplexed detection systems targeting informative COII regions

  • Create reference databases linking COII sequence variants to species distributions

These applications extend beyond traditional taxonomic uses of COII and position this recombinant protein as a valuable tool for applied conservation science in entomology.

How might the study of COII contribute to understanding mitonuclear compatibility in hybrid cricket populations?

The study of COII offers unique insights into mitonuclear compatibility in hybrid cricket populations, providing a molecular lens through which to examine evolutionary processes that maintain species boundaries:

Theoretical Framework:
Mitonuclear compatibility refers to the functional interaction between mitochondrial-encoded proteins (like COII) and nuclear-encoded proteins that form multisubunit complexes. In hybrids, mismatches between co-adapted mitochondrial and nuclear genomes can lead to fitness consequences through compromised energy metabolism. COII is particularly relevant because:

  • It directly interacts with nuclear-encoded subunits of cytochrome c oxidase

  • It participates in electron transfer with nuclear-encoded cytochrome c

  • Its function is critical for ATP production and therefore fitness

Research Approaches:

  • Comparative Energetics: Measure respiratory efficiency in purebred vs. hybrid crickets under standardized conditions

  • Protein-Protein Interaction Studies: Use recombinant COII to quantify binding efficiency with nuclear partners from different populations

  • Selection Experiments: Track changes in COII sequence frequencies in experimental hybrid populations across generations

  • Molecular Evolution Analysis: Compare rates of evolution between COII and interacting nuclear genes in hybridizing populations

Experimental Design Model:

Experiment TypeMethodologyExpected OutcomesInterpretation Framework
Hybrid Fitness AssessmentMeasure development time, ATP production, and reproductive outputReduced fitness in certain mitonuclear combinationsIdentifies incompatible genotype pairs
Molecular Binding StudiesSurface plasmon resonance with recombinant proteinsAltered binding kinetics between mismatched partnersQuantifies molecular basis of incompatibility
Gene Expression ProfilingRNA-seq of purebred vs. hybrid cricketsCompensatory upregulation of alternative pathwaysReveals adaptive responses to mitonuclear stress
Population GenomicsSequencing COII and nuclear partners in hybrid zonesConcordant clines for interacting genesMaps selection against incompatible combinations

This research direction provides a mechanistic understanding of how mitochondrial genes like COII contribute to reproductive isolation and speciation in crickets, with broader implications for evolutionary biology .

What are the best practices for maintaining and storing recombinant COII for long-term research projects?

For long-term research projects involving recombinant Acheta domesticus COII, implementing proper storage and maintenance protocols is critical to ensure protein stability and functionality. The following evidence-based best practices should be followed:

Storage Conditions:

  • Store purified protein at -80°C for long-term preservation

  • For medium-term storage (1-6 months), -20°C storage in a stabilizing buffer is acceptable

  • Working aliquots can be maintained at 4°C for up to one week

  • Avoid repeated freeze-thaw cycles by preparing single-use aliquots

Buffer Composition:

  • Optimal buffer: Tris-based buffer (pH 7.5-8.0) containing 50% glycerol

  • Include reducing agents (1-2 mM DTT or 5 mM β-mercaptoethanol) to prevent oxidation

  • Add protease inhibitors to prevent degradation during storage

  • Consider adding 0.1 mM copper to stabilize metal-binding sites

Stability Enhancement Strategies:

  • Lyophilization can provide room-temperature stability for shipping and long-term storage

  • Addition of trehalose (5-10%) improves stability during freeze-drying and reconstitution

  • For critical applications, consider chemical crosslinking to stabilize oligomeric structures

  • Validate each stabilization approach with activity assays before implementation

Quality Control Schedule:

Storage DurationRecommended QC TestsAcceptance CriteriaTesting Frequency
Short-term (< 1 month)Visual inspection, SDS-PAGENo visible precipitation, single bandBefore each use
Medium-term (1-6 months)Activity assay, thermal stability>70% of initial activity, consistent TmMonthly
Long-term (>6 months)Full characterization panel>60% of initial specificationsQuarterly

Implementing these practices ensures that recombinant COII maintains its structural integrity and functional properties throughout multi-year research projects, enhancing reproducibility and reliability of experimental outcomes.

How can findings from COII research in Acheta domesticus be applied to broader entomological studies?

Findings from COII research in Acheta domesticus can be strategically extended to broader entomological studies through several methodological approaches that leverage this model system:

Comparative Genomic Applications:

  • Use established COII protocols as templates for studying homologous proteins in non-model insects

  • Develop COII-based molecular markers for phylogenetic studies across Orthoptera

  • Compare selection patterns on COII across insect orders to identify convergent adaptation

  • Apply knowledge of cricket COII structure-function relationships to predict functional consequences of variants in other species

Physiological Research Translation:

  • Extend respiratory metabolism studies to economically important insect pests

  • Apply cricket mitochondrial function assays to examine environmental stress responses in pollinator species

  • Utilize COII as a biomarker for mitochondrial health across diverse insect taxa

  • Develop standardized protocols for measuring energetic efficiency in comparative studies

Methodological Transferability:
The detailed PCR protocols developed for cricket COII detection provide a methodological framework that can be adapted for other insect species with minimal modification. The limit of detection established for house cricket material (1 genome copy, or 2.14 pg DNA) serves as a benchmark for similar assays in other species.

Behavioral Ecology Connections:
The resource prioritization patterns observed in cricket behavioral studies can inform hypotheses about energy allocation trade-offs in other insects, with COII serving as a molecular proxy for metabolic capacity.

Implementation Strategy:

  • Identify key research questions in target insect groups that parallel established cricket COII findings

  • Modify existing protocols with species-specific optimizations

  • Validate transferability through comparative studies

  • Develop broader entomological frameworks that incorporate mitochondrial function

This translational approach maximizes the impact of cricket COII research while advancing entomological science across taxonomic boundaries.

What integrative approaches can combine COII molecular data with behavioral and ecological studies in crickets?

Integrative research approaches that combine COII molecular data with behavioral and ecological studies in crickets create powerful frameworks for understanding the connections between genotype, phenotype, and fitness in natural environments:

Field-to-Laboratory-to-Field Cycle:

  • Field Sampling: Collect crickets across ecological gradients with detailed environmental metadata

  • Molecular Profiling: Sequence COII and measure expression levels in collected individuals

  • Controlled Experiments: Test behavioral responses and physiological performance

  • Genotype-Phenotype Mapping: Correlate COII variants with performance metrics

  • Field Validation: Test predictions in natural populations through manipulative experiments

Multi-level Integration Framework:

Biological LevelCOII MeasurementBehavioral/Ecological ParameterIntegration Approach
MolecularSequence variants, expression levels-Baseline genetic characterization
CellularMitochondrial function, ATP production-Physiological foundation assessment
IndividualMetabolic rate, thermal toleranceResource selection, mating behavior Performance trait correlation
PopulationHaplotype frequenciesDensity, distribution, movement patternsSelection gradient analysis
CommunityInterspecific variationSpecies interactions, niche partitioningComparative phylogenetic methods

Experimental Design Examples:

  • Resource Prioritization Studies:

    • Correlate COII haplotypes with foraging vs. mating preferences observed in behavioral trials

    • Measure ATP production capacity of different COII variants and relate to decision-making speed

    • Track resource allocation patterns across developmental stages and relate to COII expression

  • Environmental Adaptation Research:

    • Compare COII sequence and expression in populations from different thermal environments

    • Conduct reciprocal transplant experiments measuring both COII expression and cricket fitness

    • Manipulate energy budgets experimentally and observe behavioral compensations

  • Life History Evolution Studies:

    • Correlate COII efficiency with reproductive output and lifespan

    • Examine trade-offs between current reproduction and somatic maintenance in relation to mitochondrial function

    • Track seasonal changes in COII expression and relate to life history transitions

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.