Recombinant Acholeplasma laidlawii ATP synthase subunit b (atpF)

Shipped with Ice Packs
In Stock

Description

Amino Acid Sequence and Structure

The recombinant subunit b (atpF) from Acholeplasma laidlawii (strain PG-8A) is a full-length protein expressed in E. coli. Key sequence details include:

  • Length: 175 amino acids (aa) .

  • Tag: N-terminal His-tag (as per production protocols) .

Functional Role

Subunit b is part of the peripheral stalk in ATP synthase, linking the membrane-integrated F(0) sector to the soluble F(1) catalytic domain. Its primary roles include:

  • Stator Function: Preventing rotation of the F(1) subunits during proton translocation .

  • Dimerization: Mediating interactions between subunits to maintain structural integrity .

Recombinant Expression

The protein is expressed in E. coli and purified for research use. Key production parameters:

ParameterValueSource
HostE. coli
Storage BufferTris-based buffer, 50% glycerol
Storage Temperature-20°C or -80°C

Dimerization and Coiled-Coil Structure

In E. coli, the b subunit forms a dimer through a right-handed coiled-coil structure, critical for stabilizing the ATP synthase complex . This structural feature is conserved in Acholeplasma, as inferred from sequence homology and functional studies. Mutations in conserved residues (e.g., Arg-83 in E. coli) disrupt dimerization, highlighting its importance in proton-driven ATP synthesis .

Conservation Across Species

The b subunit is highly conserved in bacterial ATP synthases. For example:

OrganismSubunit LengthKey Features
Acholeplasma laidlawii175 aaMembrane-anchored, peripheral stalk role
E. coli156 aaDimerization via coiled-coil, proton channel interaction

ELISA and Antibody Detection

The recombinant protein is used in enzyme-linked immunosorbent assays (ELISA) to detect antibodies against ATP synthase subunit b, aiding in studies of bacterial pathogenesis and immune responses .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
atpF; ACL_0986; ATP synthase subunit b; ATP synthase F(0 sector subunit b; ATPase subunit I; F-type ATPase subunit b; F-ATPase subunit b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-175
Protein Length
full length protein
Species
Acholeplasma laidlawii (strain PG-8A)
Target Names
atpF
Target Protein Sequence
MDIFKEISDAIQEGLNSIFERWDLVLWQIAATVILIIVVRIFLWKPITRYLEQRQEALSK ELHEAAHERERVAQIRYELQTEYEVMRKEARQMKDTLMSEAQLEKERIISDARNEAKRRI QQVDRDVQQELRLQSEKIRENIKNIAFDVAEKIVSHQVTDENIDEVIDEMLDEKL
Uniprot No.

Target Background

Function
F(1)F(0) ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the F(1) domain, containing the extramembranous catalytic core, and the F(0) domain, containing the membrane proton channel. These domains are connected by a central and a peripheral stalk. ATP synthesis in the F(1) catalytic domain is coupled to proton translocation via a rotary mechanism involving the central stalk subunits. This protein is a component of the F(0) channel, forming part of the peripheral stalk and linking F(1) to F(0).
Database Links
Protein Families
ATPase B chain family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is the significance of ATP synthase in Acholeplasma laidlawii compared to other bacterial species?

ATP synthase in A. laidlawii functions as a (Na+ + Mg2+)-ATPase, which differs from the predominantly H+-driven ATP synthases found in many other bacteria. This adaptation may represent an evolutionary response to the membrane composition and environmental niche of this organism. Research demonstrates that the purified, lipid-reconstituted enzyme shows high sensitivity to chemical modifications, with inactivation occurring when specific amino acids are modified. The modification of one reactive lysine by dinitrofluorobenzene, one reactive arginine by phenylglyoxal, or two tyrosine residues by specific reagents results in complete inactivation of the enzyme . This sensitivity suggests critical roles for these residues in catalytic activity or structural integrity.

What expression systems are most effective for producing recombinant A. laidlawii ATP synthase subunit b?

E. coli remains the predominant expression system for recombinant A. laidlawii proteins. While not specifically documented for ATP synthase subunit b, research on recombinant proteins from related organisms suggests the effectiveness of E. coli-based expression systems with N-terminal His tags to facilitate purification . The standard genetic code used by A. laidlawii (unlike most Mollicutes) makes it amenable to expression in common bacterial hosts without codon optimization .

When expressing A. laidlawii proteins, researchers should consider:

  • Using low-temperature induction to minimize inclusion body formation

  • Optimizing growth media to account for the unusual membrane composition of the native organism

  • Including appropriate cofactors during purification to maintain structural integrity

  • Incorporating lipid reconstitution steps to restore full functional activity

What are the optimal conditions for purifying recombinant A. laidlawii ATP synthase subunit b while maintaining its activity?

Purification of recombinant A. laidlawii ATP synthase subunit b requires careful consideration of its membrane-associated nature. Research on similar proteins suggests the following optimized protocol:

  • Expression in E. coli with an N-terminal His tag

  • Cell lysis under mild conditions to prevent protein denaturation

  • Affinity chromatography using Ni-NTA resin under non-denaturing conditions

  • Lipid reconstitution with appropriate phospholipids to restore native-like environment

  • Storage in buffer containing glycerol to prevent freeze-thaw damage

The purified protein should be stored at -20°C or -80°C with aliquoting to avoid repeated freeze-thaw cycles, which can significantly reduce activity. A storage buffer containing Tris/PBS with 6% trehalose at pH 8.0 has been shown to be effective for similar membrane proteins . For reconstitution, the protein should be dissolved in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with 5-50% glycerol added as a cryoprotectant .

How can the interaction between ATP synthase subunit b and other components of the A. laidlawii molecular machinery be studied?

Investigating protein-protein interactions involving A. laidlawii ATP synthase subunit b can be approached using multiple complementary techniques:

  • Co-immunoprecipitation: Using antibodies against the His-tagged recombinant ATP synthase subunit b to pull down interacting proteins from A. laidlawii cell lysates.

  • Bio-layer interferometry: This technique has been successfully employed to study interactions between recombinant proteins from A. laidlawii. For example, interactions between AlIbpA and other heat shock proteins (AlDnaK and AlClpB) were characterized with dissociation constants of 3.1 ± 0.3 μM and 1.2 ± 0.2 μM, respectively .

  • Co-elution studies: Pre-incubation of His-tagged recombinant protein with A. laidlawii cell extracts followed by purification on Ni-NTA Sepharose and identification of co-eluted proteins by LC-MS has proven effective. This approach identified interactions between AlIbpA and various heat shock proteins as shown in Table 1 .

ProteinScoreemPAI
4 °C30 °C42 °C4 °C30 °C42 °C
AlDnaK465150814120.470.730.83
AlClpB22253211,7030.090.312.72

The data demonstrates temperature-dependent interactions, with stronger associations at stress temperatures (42°C), as indicated by higher emPAI values .

What methods are most effective for assessing the enzymatic activity of recombinant A. laidlawii ATP synthase?

The enzymatic activity of recombinant A. laidlawii ATP synthase can be measured using several approaches:

  • ATP hydrolysis assay: Monitoring the release of inorganic phosphate using colorimetric methods (malachite green or molybdate-based assays).

  • Coupled enzyme assays: Linking ATP hydrolysis to NADH oxidation through pyruvate kinase and lactate dehydrogenase, allowing spectrophotometric monitoring at 340 nm.

  • Bioluminescence assays: Measuring ATP concentrations using luciferase-based detection systems.

When designing activity assays, researchers should consider the unique cation requirements of the A. laidlawii ATP synthase, which functions as a (Na+ + Mg2+)-ATPase . Furthermore, the effect of lipid environment on enzyme activity should be evaluated, as studies on A. laidlawii membrane proteins indicate strong dependence on membrane composition and physical properties .

Which amino acid residues are critical for the catalytic activity of A. laidlawii ATP synthase subunit b?

Research on A. laidlawii ATPase has identified several amino acid residues crucial for enzymatic activity. Chemical modification studies revealed:

  • Lysine residues: Modification of one reactive lysine by dinitrofluorobenzene results in complete inactivation.

  • Arginine residues: Modification of one reactive arginine by phenylglyoxal leads to complete inactivation.

  • Tyrosine residues: Modification of two tyrosine residues by 4-chloro-7-nitrobenzo-2-oxa-1,3-diazole or fluorosulfonylbenzoyl adenosine results in complete inactivation.

  • Sulfhydryl groups: Partial inactivation occurs with N-ethylmaleimide and p-chloromercuribenzene sulfonic acid.

  • Carboxylic acid groups: Partial inactivation with dicyclohexylcarbodiimide and Woodward's reagent K suggests involvement in activity maintenance .

These findings indicate that specific lysine, arginine, and tyrosine residues play direct roles in catalysis or substrate binding, while sulfhydryl and carboxylic acid groups may have indirect roles in maintaining the enzyme's structural integrity or subunit interactions.

How does the membrane lipid environment affect the function of A. laidlawii ATP synthase?

The function of A. laidlawii ATP synthase is highly dependent on its membrane lipid environment. Studies on A. laidlawii membrane lipid biosynthesis reveal sophisticated mechanisms for maintaining appropriate membrane fluidity:

  • The fatty acid chain elongation system in A. laidlawii has broad substrate specificity, accommodating various fatty acid structures including straight-chain, methyl isobranched, and methyl anteisobranched saturated fatty acids, as well as monounsaturated, cyclopropane, and polyunsaturated fatty acids .

  • The extent of chain elongation correlates with the physical properties (melting temperatures) of the exogenous fatty acid substrates, suggesting a regulatory mechanism that maintains membrane fluidity within a specific range .

  • For optimal ATP synthase activity, the reconstitution with appropriate lipids is crucial, as the native enzyme functions in a lipid-reconstituted form .

This relationship between membrane composition and enzyme activity suggests that alterations in membrane fluidity could significantly impact ATP synthase function, potentially serving as a regulatory mechanism in response to environmental changes.

What are the challenges in expressing A. laidlawii membrane proteins in heterologous systems?

Expressing A. laidlawii membrane proteins in heterologous systems presents several challenges:

  • Membrane composition differences: A. laidlawii has a unique membrane lipid composition adapted to life without a cell wall. The fatty acid chain elongation system in A. laidlawii maintains membrane fluidity within a specific range , which may not be replicated in heterologous expression systems.

  • Protein folding and stability: Membrane proteins often require specific chaperones for proper folding. A. laidlawii possesses unique chaperones like AlIbpA that can form both globular and fibrillar structures, combining functions found in separate proteins in other organisms .

  • Post-translational modifications: Any specific modifications required for ATP synthase function may be absent in heterologous systems.

  • Functional reconstitution: After purification, recombinant membrane proteins need to be reconstituted in appropriate lipid environments to restore activity.

These challenges can be addressed by:

  • Using expression hosts with similar membrane compositions

  • Co-expressing relevant chaperones

  • Optimizing growth conditions to reduce protein aggregation

  • Developing effective lipid reconstitution protocols

How can genetic tools be optimized for studying A. laidlawii ATP synthase in vivo?

Recent advances in genetic tools for A. laidlawii provide new opportunities for in vivo studies of ATP synthase. Research has led to the development of multi-host shuttle plasmids optimized for electroporation in A. laidlawii . Unlike most Mollicutes, A. laidlawii uses a standard genetic code, which simplifies genetic manipulation strategies .

For studying ATP synthase in vivo, researchers can consider:

  • Gene tagging approaches: Introducing epitope tags or fluorescent protein fusions to ATP synthase subunits using shuttle vectors.

  • Conditional expression systems: Developing inducible promoters to control expression of wild-type or mutant ATP synthase components.

  • CRISPR-Cas9 genome editing: Adapting CRISPR systems for targeted modification of ATP synthase genes.

  • Whole-genome sequencing: Monitoring genetic changes in response to ATP synthase modifications, similar to the donor-recipient relationship studies conducted for A. laidlawii strains .

These approaches would benefit from the expanding genetic toolbox being developed for A. laidlawii, potentially enabling synthetic biology applications and more detailed structure-function studies.

How is A. laidlawii ATP synthase being used to understand energy metabolism in wall-less bacteria?

A. laidlawii ATP synthase serves as an important model for understanding energy metabolism in wall-less bacteria and Mollicutes. As a (Na+ + Mg2+)-ATPase rather than the more common H+-ATPase , it represents an adaptation to the organism's unique cellular environment.

Research applications include:

  • Comparative studies: Comparing the structure and function of A. laidlawii ATP synthase with those from other bacteria to understand evolutionary adaptations in energy metabolism.

  • Bioenergetics investigations: Using recombinant A. laidlawii ATP synthase to study the coupling between ion gradients and ATP synthesis/hydrolysis.

  • Membrane-protein interactions: Examining how the unique membrane composition of wall-less bacteria affects ATP synthase function and stability.

  • Minimal cellular energy requirements: Contributing to our understanding of the minimal energy generation systems required for cellular life, particularly relevant in the context of synthetic biology approaches to minimal cell creation .

What insights can structural studies of A. laidlawii ATP synthase provide about membrane protein adaptation?

Structural studies of A. laidlawii ATP synthase can provide valuable insights into membrane protein adaptation in organisms with distinctive membrane compositions:

  • Lipid-protein interactions: Understanding how specific lipid compositions affect ATP synthase structure and function, given that A. laidlawii has sophisticated mechanisms for maintaining membrane fluidity .

  • Ion specificity determinants: Identifying structural features that confer specificity for Na+ rather than H+ as the coupling ion.

  • Adaptation to extreme environments: A. laidlawii can grow under various conditions, and structural adaptations in its ATP synthase may reveal mechanisms for energy conservation under stress.

  • Evolutionary insights: Comparing the structure of A. laidlawii ATP synthase with those from related and distant organisms can illuminate evolutionary pathways in the development of F-type ATPases.

An important research finding is that modification of specific amino acid residues (lysine, arginine, tyrosine) leads to complete inactivation of the enzyme , suggesting these residues have critical structural or functional roles that could be further elucidated through detailed structural studies.

How might synthetic biology approaches utilize recombinant A. laidlawii ATP synthase?

Synthetic biology approaches could leverage recombinant A. laidlawii ATP synthase in several innovative ways:

  • Minimal cell design: A. laidlawii is being developed as a chassis for synthetic genome creation . Understanding and potentially redesigning its ATP synthase could be crucial for optimizing energy metabolism in synthetic minimal cells.

  • Bionanotechnology applications: The unique structural properties of A. laidlawii ATP synthase could be exploited to develop nanoscale rotary motors or energy-generating components for synthetic systems.

  • Membrane protein engineering: Insights from A. laidlawii ATP synthase could guide the design of membrane proteins with enhanced stability or altered ion specificity.

  • Biosensors: Modified versions of the ATP synthase could potentially serve as biosensors for specific ions or membrane perturbations.

The expanding genetic toolbox for A. laidlawii, including multi-host shuttle plasmids , provides a foundation for these synthetic biology applications.

What methods show promise for studying the dynamic assembly and regulation of A. laidlawii ATP synthase in native-like conditions?

Emerging methodologies for studying dynamic aspects of A. laidlawii ATP synthase include:

  • Single-molecule techniques: Methods such as single-molecule FRET or high-speed AFM could reveal conformational changes during the catalytic cycle.

  • Native mass spectrometry: This approach could provide insights into subunit stoichiometry and interactions under varying conditions.

  • Cryo-electron microscopy: Recent advances in cryo-EM resolution could enable structural determination of the entire ATP synthase complex in different functional states.

  • In-cell NMR: This technique could potentially monitor structural changes in ATP synthase components within living cells.

  • Nanodiscs and liposome reconstitution: These systems provide native-like membrane environments for functional studies. Drawing parallels from research on A. laidlawii heat shock proteins, which demonstrated successful reconstitution and functional analysis of membrane-associated proteins , similar approaches could be applied to ATP synthase.

These methods, combined with the genetic tools being developed for A. laidlawii , promise to provide unprecedented insights into the structure, function, and regulation of this unique ATP synthase.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.