Recombinant Acholeplasma laidlawii Ribonuclease Y (rny)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
rny; ACL_0886; Ribonuclease Y; RNase Y
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-526
Protein Length
full length protein
Species
Acholeplasma laidlawii (strain PG-8A)
Target Names
rny
Target Protein Sequence
MFNVDTPALITFILLIVVGALGGALVGYFIRVAQHEKSLRLAREEAERIIEDGKKEADRT KREMVFEAKQEILTLRKEFDEDIKDRRQIVMNLEEKATQRENALNQRSQYLDKREIGLDA KEERHNERKEQLDIQYSKVEELIKEQEEKLSSISALSREQARELIMAQVRDSISNEIAAY IRDEEDNAKSIAQNKSKEILSLAMQKYAAETTSERTVTVVEIPNEDMKGRIIGKEGRNIR SLEALTGVDLIIDDTPEAVVLSGFDPVRREVAKRALTILVQDGRIHPGRIEEVVERARTE IDMFIREAGEEAVFKTGVGKVHPDIIKLLGRMTFRTSYGQNVLKHSIEVAFLAGKLAAEI GENEMLARRAGLFHDIGKAIDHEVEGSHVSIGVELMSRYKEPKEVIDAIASHHGDSEPES IIAVLVAAADALSAARPGARSESMDSYMKRLTQLEEISNDVTGVDKAYAIQAGREVRVMV LPDKVDDLGLINIARTIKEKIEAQMTYPGTIKVTVIREKRATDVAK
Uniprot No.

Target Background

Function
Endoribonuclease initiating mRNA decay.
Database Links
Protein Families
RNase Y family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is Ribonuclease Y (rny) from Acholeplasma laidlawii and what is its primary function?

Ribonuclease Y (rny) from Acholeplasma laidlawii is an endoribonuclease that initiates mRNA decay pathways. As a member of the RNase Y family, it plays a crucial role in RNA processing and degradation within the bacterial cell . The enzyme specifically targets and cleaves RNA molecules, contributing to the regulation of gene expression and RNA turnover. In bacterial systems, this function is essential for controlling transcript levels and responding to changing environmental conditions.

What are the structural characteristics of Acholeplasma laidlawii rny?

Acholeplasma laidlawii Ribonuclease Y is a 526 amino acid protein with a molecular mass of approximately 59 kDa . The complete amino acid sequence is:

MFNVDTPALITFILLIVVGALGGALVGYFIRVAQHEKSLRLAREEAERIIEDGKKEADRTKREMVFEAKQEILTLRKEFDEDIKDRRQIVMNLEEKATQRENALNQRSQYLDKREIGLDAKEERHNERKEQLDIQYSKVEELIKEQEEKLSSISALSREQARELIMAQVRDSISNEIAAYIRDEEDNAKSIAQNKSKEILSLAMQKYAAETTSERTVTVVEIPNEDMKGRIIGKEGRNIRSLEALTGVDLIIDDTPEAVVLSGFDPVRREVAKRALTILVQDGRIHPGRIEEVVERARTEIDMFIREAGEEAVFKTGVGKVHPDIIKLLGRMTFRTSYGQNVLKHSIEVAFLAGKLAAEIGENEMLARRAGLFHDIGKAIDHEVEGSHVSIGVELMSRYKEPKEVIDAIASHHGDSEPESIIAVLVAAADALSAARPGARSESMDSYMKRLTQLEEISNDVTGVDKAYAIQAGREVRVMVLPDKVDDLGLINIARTIKEKIEAQMTYPGTIKVTVIREKRATDVAK

The protein structure likely includes catalytic domains typical of endoribonucleases, although detailed crystallographic data is not provided in the available research.

How can researchers effectively express and purify recombinant A. laidlawii Ribonuclease Y?

Expression and purification of recombinant A. laidlawii Ribonuclease Y typically follows standard recombinant protein methodology with adaptations specific to this enzyme:

  • Expression system selection: E. coli is commonly used for expression of bacterial proteins like rny, although eukaryotic expression systems may be considered for specific applications.

  • Vector construction: For optimal expression, the rny gene should be cloned into an expression vector with appropriate promoters and affinity tags (commonly His-tag for ease of purification) .

  • Expression conditions: Induction parameters (temperature, inducer concentration, duration) should be optimized to maximize soluble protein yield while minimizing inclusion body formation.

  • Purification protocol:

    • Initial capture via affinity chromatography (IMAC for His-tagged proteins)

    • Secondary purification via ion exchange chromatography

    • Final polishing step using size exclusion chromatography

    • Buffer optimization to maintain enzymatic activity

  • Quality control: SDS-PAGE analysis to confirm the expected molecular weight (approximately 59 kDa), Western blotting for identity confirmation, and activity assays to verify functional integrity.

What are the recommended activity assays for validating recombinant rny function?

To validate the enzymatic activity of recombinant rny, researchers can employ these methodological approaches:

  • RNA cleavage assays: Using synthetic RNA substrates with fluorescent labels or radiolabeled RNA to detect cleavage products.

  • Kinetic analysis: Determining enzyme kinetics parameters (Km, Vmax, kcat) using varying substrate concentrations under controlled conditions.

  • Specificity testing: Assessing substrate specificity by testing the enzyme against different RNA sequences and structures.

  • Inhibition studies: Evaluating the effect of known ribonuclease inhibitors to confirm the characteristic profile of RNase Y.

  • In vivo complementation: Testing whether the recombinant protein can restore RNA processing functions in rny-deficient bacterial strains.

How does A. laidlawii Ribonuclease Y compare with RNase Y from other bacterial species at the functional level?

While specific comparative data for A. laidlawii RNase Y is limited in the search results, researchers investigating functional comparisons should consider these methodological approaches:

  • Phylogenetic analysis: Construct phylogenetic trees based on sequence alignment to determine evolutionary relationships between RNase Y from different bacterial species.

  • Substrate preference profiling: Compare cleavage patterns and efficiency across different RNA substrates to identify species-specific preferences.

  • Structural comparison: Analyze conserved domains and variations in protein structure that might account for functional differences.

  • Expression pattern analysis: Investigate differences in expression regulation across species using RT-PCR and other gene expression techniques.

  • Knockout comparison studies: Assess the phenotypic effects of RNase Y deletion in different bacterial species to understand functional conservation and divergence.

Particular attention should be given to comparing A. laidlawii RNase Y with homologs from species such as Streptococcus agalactiae, Staphylococcus aureus, and other bacteria listed in the search results .

What role does Ribonuclease Y play in A. laidlawii pathogenicity and host interactions?

The relationship between Ribonuclease Y and A. laidlawii pathogenicity is a complex area requiring multifaceted investigation:

  • Host immune response: Research indicates that A. laidlawii stimulation can augment granulysin mRNA expression in human monocytic cell lines like THP-1 , suggesting potential interactions with host immunity. Although this isn't directly linked to RNase Y in the available data, it provides context for studying pathogen-host interactions.

  • Virulence gene regulation: Researchers should investigate whether rny regulates the expression of virulence factors through its mRNA processing activity.

  • Survival mechanisms: Examine if rny contributes to bacterial adaptation to host environments through regulation of stress response genes.

  • Experimental approaches:

    • Gene knockout studies to determine the effect of rny deletion on bacterial virulence

    • Transcriptomic analysis to identify mRNAs specifically processed by rny during infection

    • Host cell infection models comparing wild-type and rny-mutant strains

What are the current challenges in studying the regulatory mechanisms of rny expression and activity?

Researchers face several methodological challenges when investigating rny regulation:

  • Limited model systems: A. laidlawii is less studied compared to other bacterial models, necessitating adaptation of protocols from better-characterized systems.

  • Complex regulation: RNA processing enzymes often have complex regulatory mechanisms involving both transcriptional and post-transcriptional controls.

  • Functional redundancy: Other ribonucleases may compensate for rny deficiency, complicating functional studies.

  • Methodological considerations for addressing these challenges:

    • Development of A. laidlawii-specific genetic tools

    • Application of global approaches (RNA-seq, proteomics) to identify regulatory networks

    • Use of conditional expression systems to study essential genes

    • Integration of computational modeling with experimental data

How can researchers design experiments to study the specific RNA targets of A. laidlawii Ribonuclease Y?

To identify and characterize specific RNA targets of rny, researchers should consider these methodological approaches:

  • CLIP-seq (Cross-linking Immunoprecipitation followed by sequencing):

    • Cross-link RNA-protein complexes in vivo

    • Immunoprecipitate rny with bound RNA fragments

    • Sequence and analyze the captured RNA fragments

    • Map binding sites to identify recognition motifs

  • Differential RNA-seq analysis:

    • Compare transcriptome profiles between wild-type and rny-deficient strains

    • Identify transcripts with altered abundance or processing

  • In vitro cleavage assays:

    • Test candidate RNA substrates with purified recombinant rny

    • Map cleavage sites using primer extension or RNA sequencing

  • Structural analysis of RNA-protein complexes:

    • Use techniques like X-ray crystallography or cryo-EM to determine interaction interfaces

    • Identify structural features of substrate recognition

What methodologies are recommended for studying the interplay between A. laidlawii RNase Y and other RNA processing enzymes?

RNA metabolism involves coordinated activities of multiple enzymes. To investigate these relationships, researchers should:

  • Proteomic approaches:

    • Co-immunoprecipitation to identify protein-protein interactions

    • Mass spectrometry to characterize rny-containing complexes

    • Yeast two-hybrid screens to detect direct interactions

  • Genetic interaction studies:

    • Double knockout/knockdown experiments to identify synthetic effects

    • Suppressor screens to identify compensatory pathways

  • Sequential activity assays:

    • Design experiments where RNA substrates are sequentially treated with different enzymes

    • Analyze how initial processing by one enzyme affects subsequent processing by others

  • Localization studies:

    • Determine subcellular localization of rny and other RNA processing enzymes

    • Assess co-localization patterns using fluorescence microscopy

What are appropriate controls and statistical approaches for analyzing RNase Y activity data?

Rigorous control design and statistical analysis are crucial for rny activity studies:

  • Essential controls:

    • Negative controls: heat-inactivated enzyme, no-enzyme reactions

    • Positive controls: well-characterized ribonucleases with known activity

    • Substrate controls: non-target RNA sequences to confirm specificity

  • Statistical considerations:

    • Minimum of 3-5 biological replicates for robust statistical power

    • Appropriate parametric or non-parametric tests based on data distribution

    • Multiple testing correction for large-scale studies (FDR or Bonferroni)

  • Data visualization:

    • Activity curves showing enzyme kinetics

    • Cleavage site mapping with nucleotide-level resolution

    • Comparative activity plots across different conditions

How can researchers resolve contradictory data about RNase Y function?

When facing conflicting results about rny function, researchers should implement these methodological strategies:

  • Systematic review of methodological differences:

    • Evaluate differences in expression systems, purification methods, and assay conditions

    • Assess genetic background variations in model organisms

    • Consider species-specific differences if comparing RNase Y from different bacteria

  • Independent validation:

    • Employ multiple complementary techniques to verify findings

    • Collaborate with independent laboratories for validation

    • Use both in vitro and in vivo approaches to confirm results

  • Context-dependent function analysis:

    • Investigate whether contradictory results might reflect genuine biological variability

    • Examine whether rny function changes under different physiological conditions

    • Consider the influence of experimental conditions on enzyme behavior

What techniques can researchers use to study the interplay between A. laidlawii and host gene expression?

The search results indicate that A. laidlawii can influence host gene expression, particularly granulysin gene expression in human monocytic cells . To study such interactions, researchers can use:

  • RT-PCR analysis: For targeted gene expression studies, as demonstrated in the research where granulysin mRNA expression was shown to be augmented in THP-1 cells in response to A. laidlawii in a dose-dependent manner .

  • Promoter activity analysis: Using reporter gene constructs to identify regulatory regions responsive to bacterial stimulation. Previous research identified that DNA sequences between residues −329 and −239 in the granulysin promoter are responsible for mediating gene induction by A. laidlawii .

  • Transcription factor analysis: Using techniques like Electrophoretic Mobility Shift Assays (EMSA) to identify specific transcription factor binding. For example, research showed that AP-1 binding to the granulysin promoter is induced by A. laidlawii stimulation .

  • Conditional expression systems: As exemplified by studies using THP-1/tTA + LAP cells to examine how liver-enriched transcriptional activator protein (LAP) influences A. laidlawii-induced gene expression .

How can researchers design experiments to investigate rny's role in regulating bacterial gene expression networks?

To investigate how rny contributes to bacterial gene regulatory networks:

  • Transcriptome analysis:

    • RNA-seq comparing wild-type and rny-deficient strains

    • Time-course analysis to capture dynamic changes in gene expression

    • Stress response profiling to identify condition-specific regulatory roles

  • Integration with other omics data:

    • Combine transcriptomics with proteomics and metabolomics

    • Correlate changes in mRNA levels with protein abundance

    • Construct network models incorporating multiple data types

  • Direct vs. indirect effects differentiation:

    • Use rapid enzyme inactivation approaches to distinguish immediate targets

    • Apply ribosome profiling to assess effects on translation

    • Implement systems biology approaches to model regulatory cascades

What are common issues in rny protein expression and how can they be resolved?

Researchers may encounter several challenges when expressing recombinant rny:

  • Low solubility:

    • Optimize induction conditions (lower temperature, reduced inducer concentration)

    • Use solubility-enhancing fusion tags (SUMO, MBP, etc.)

    • Explore refolding protocols if inclusion bodies form

  • Proteolytic degradation:

    • Include protease inhibitors during purification

    • Use protease-deficient expression strains

    • Optimize buffer conditions to minimize proteolysis

  • Loss of activity during purification:

    • Test different buffer compositions to maintain stability

    • Consider metal ion requirements (common for ribonucleases)

    • Minimize freeze-thaw cycles and store with stabilizing agents

  • Contaminating nucleases:

    • Implement rigorous RNase-free techniques throughout purification

    • Include additional purification steps to remove contaminants

    • Verify purity using activity assays with control substrates

How can researchers overcome difficulties in assessing rny activity in complex biological samples?

Working with rny in complex samples presents unique challenges:

  • Background nuclease activity:

    • Develop rny-specific inhibitors or antibodies

    • Use selective activity assays based on unique substrate preferences

    • Employ genetic approaches (knockouts, knockdowns) to create control samples

  • Substrate accessibility:

    • Consider RNA structural effects on enzyme accessibility

    • Account for competitive binding by endogenous RNA-binding proteins

    • Use in vivo RNA structure probing to assess target accessibility

  • Detection sensitivity:

    • Implement amplification steps in detection methods

    • Use fluorescent or radioactive labeling for enhanced sensitivity

    • Consider single-molecule approaches for detailed mechanistic studies

What are the most promising future research directions for A. laidlawii Ribonuclease Y?

Based on current knowledge and gaps in the literature, researchers should consider these future directions:

  • Structural biology:

    • Determine high-resolution structures of rny alone and in complex with substrates

    • Identify key residues for catalysis and substrate recognition

    • Develop structure-based inhibitors as research tools

  • Systems biology:

    • Map the complete RNA regulon controlled by rny

    • Identify regulatory networks involving rny across different growth conditions

    • Model the impact of rny on bacterial physiology

  • Comparative biology:

    • Conduct comprehensive comparisons of RNase Y across bacterial species

    • Identify evolutionary adaptations in substrate specificity

    • Explore potential specialization of function in different bacterial lineages

  • Host-pathogen interactions:

    • Investigate whether rny contributes to immune evasion mechanisms

    • Explore potential applications in understanding bacterial pathogenesis

    • Examine cross-kingdom RNA interactions mediated by bacterial ribonucleases

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.