Recombinant Acholeplasma phage L2 Uncharacterized 66.6 kDa protein

Shipped with Ice Packs
In Stock

Description

Source and Expression

  • Host organism: Acholeplasma phage L2 (Plasmaviridae family) .

  • Expression system: Recombinant protein produced in Escherichia coli with an N-terminal His tag .

  • Protein length: 591 amino acids (1–591 aa) .

Biochemical Properties

PropertyDetails
Molecular weight66.6 kDa
Purity>90% (verified by SDS-PAGE)
Storage bufferTris/PBS-based buffer with 6% trehalose (pH 8.0)
ReconstitutionRecommended in deionized water (0.1–1.0 mg/mL) with 50% glycerol

Genomic Context

ORF1 is the largest open reading frame (66.6 kDa) in the Acholeplasma phage L2 genome. Key genomic features include :

ORFSize (kDa)Function
166.6Uncharacterized protein
534.9Putative integrase
1381.3Integral membrane protein

Role in Phage Biology

  • ORF1 is transcribed early during the non-cytocidal infection cycle but lacks confirmed enzymatic or structural roles .

  • Unlike ORF12 (DNA-binding protein) or ORF13 (membrane protein), ORF1’s function remains uncharacterized despite its prominence in the proteome .

Interactions and Pathways

  • No experimentally validated interactions or pathways are reported .

  • Hypothesized to assist in phage genome replication or integration due to its position near replication origins (ori1 and ori2) .

Experimental Use

  • Primary application: SDS-PAGE analysis .

  • Limitations: Not for human consumption; avoid repeated freeze-thaw cycles .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format we currently have in stock. However, if you have a specific format requirement, kindly indicate it when placing your order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery timelines, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us beforehand, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which you can use as a reference.
Shelf Life
Shelf life is dependent on several factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please let us know, and we will prioritize developing the specified tag.
Synonyms
Uncharacterized 66.6 kDa protein; ORF1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-591
Protein Length
full length protein
Species
Acholeplasma phage L2 (Bacteriophage L2)
Target Protein Sequence
MLMMVIRIYIHKRLNAKDYNNFYTSIGDFGYTIPGSDAPQYNIESDSEHYLNFGIAHINF NNGTNNQITNPNPEVYTRFYIQMKTPDGQDRIVYEAENANAISFLIRSTYHKPMSGLVGG FRFDPLLGIRVYKDSFVLADELARIQSEFTTVYGNSGINVTENTTNYSVRMYWESAVVVE PGEPSPENPIPWLSNLPNITDGNPENIDGQWGNVTGFNYNPTTKLFNADVIYDGNSYPIR DAVVASNDDSFLTRTEKAYYFTQGGQKFLYLNFSKDIDSFMFKNHYSELKNWVGHALWNL STGEVNVMEQLKVFQYLKFTEDNELMAYFYIVDTPVDDLISVTSNVAYRYWKPTWFGLGP KEPGPIQNKIITAAQGEFNSIRPTWVKPVYLGSYFAGASGLVIAGSALIKGGSPWFGLGL AGVGILAGGILQYADDNEWLNYDIAQVQKLEPNVNIRSEISEAYFNAYGQMFPSTLGQSL YRISYGQFDQSDLQVISDKSDVITVVFETDGITHTYQKDQIDDTWDGPATEIPLGVDGIL PEWALWLITIVIGLFALSNLQKIFDTIKKKPIISIIVVIAILYALTYFNLL
Uniprot No.

Target Background

Database Links

KEGG: vg:1261009

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Acholeplasma phage L2 and what is its taxonomic classification?

Acholeplasma phage L2 is the type species of the genus Plasmavirus within the family Plasmaviridae. It is a temperate enveloped mycoplasma virus that infects Acholeplasma laidlawii cells, a wall-less bacterium belonging to the class Mollicutes . Unlike most phages that infect bacteria with cell walls, this phage has evolved to infect wall-less bacteria, making it relatively unique among bacteriophages. The virus exists as a temperate phage, meaning it can either enter a lytic cycle (producing progeny virions and lysing the host cell) or enter a lysogenic cycle where the viral genome integrates into the host genome .

The taxonomic hierarchy is as follows:

  • Family: Plasmaviridae

  • Genus: Plasmavirus

  • Type species: Acholeplasma phage L2

As the only recognized member of its family in the ICTV Ninth Report taxonomy release, the family description corresponds to the genus description .

What are the morphological characteristics of Acholeplasma phage L2 virions?

Acholeplasma phage L2 virions display several distinct morphological features:

  • They are quasi-spherical, slightly pleomorphic, and enveloped particles

  • The average diameter is approximately 80 nm, with a size range of 50-125 nm

  • Three distinct morphological forms (L2-I, L2-II, and L2-III) are produced during infection

  • These forms can be differentiated by velocity sedimentation and agarose gel electrophoresis

  • Specific measured diameters for each form are: L2-I (74 nm), L2-II (88 nm), and L2-III (132 nm)

Thin-section electron microscopy reveals virions with densely stained centers, presumably containing condensed DNA, as well as particles with lucent centers. Unlike many phages, Acholeplasma phage L2 lacks a regular capsid structure, suggesting that the virion is an asymmetric nucleoprotein condensation bounded by a lipid-protein membrane .

What is known about the 66.6 kDa protein of Acholeplasma phage L2?

The 66.6 kDa protein (P42536) is encoded by ORF 1 in the Acholeplasma phage L2 genome. Here are the key characteristics:

  • It is a full-length protein consisting of 591 amino acids

  • The function remains uncharacterized, hence the designation "uncharacterized"

  • The complete amino acid sequence is known (see section 1.4 for the sequence)

  • Based on its designation as ORF 1 and size, it may play an important structural or enzymatic role in the phage life cycle

In the context of the phage proteome, the virion contains at least four major proteins of about 64, 61, 58, and 19 kDa, along with several minor proteins. While the exact correspondence between these observed proteins and the genomic ORFs is not fully established in the literature, the 66.6 kDa protein may correspond to one of these major virion proteins .

How is the recombinant 66.6 kDa protein typically produced for research?

The recombinant Acholeplasma phage L2 66.6 kDa protein is typically produced using the following methodology:

  • Expression system: Escherichia coli bacterial expression system

  • Fusion tag: N-terminal histidine (His) tag to facilitate purification

  • Expression construct: Full-length protein (amino acids 1-591)

  • Purification method: Affinity chromatography using the His-tag

  • Final form: Lyophilized powder with >90% purity as determined by SDS-PAGE

  • Storage buffer: Tris/PBS-based buffer with 6% Trehalose, pH 8.0

This expression and purification approach allows researchers to obtain relatively large quantities of purified protein for functional or structural studies. The His-tag enables efficient purification via immobilized metal affinity chromatography (IMAC), while maintaining protein solubility and stability .

What are the recommended storage and handling conditions for the recombinant protein?

For optimal stability and activity of the recombinant Acholeplasma phage L2 66.6 kDa protein, the following storage and handling conditions are recommended:

  • Storage temperature: Store at -20°C or -80°C upon receipt

  • Aliquoting: Divide into working aliquots to minimize freeze-thaw cycles

  • Short-term storage: Store working aliquots at 4°C for up to one week

  • Reconstitution procedure:

    • Briefly centrifuge the vial before opening to bring contents to the bottom

    • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Add glycerol to 5-50% final concentration (50% is recommended) for long-term storage

  • Avoid: Repeated freeze-thaw cycles should be avoided as they may compromise protein integrity

These conditions are designed to maintain protein stability and prevent degradation or aggregation that could interfere with experimental results.

How do the three morphological forms of Acholeplasma phage L2 differ in structure and genome content?

Acholeplasma phage L2 produces three distinct morphological forms during infection (L2-I, L2-II, and L2-III) that differ in several key aspects:

FeatureL2-IL2-IIL2-III
Diameter74 nm88 nm132 nm
Genome copies12-31
Protein compositionSame proteins as other formsSame proteins as other formsSame proteins as other forms
Protein stoichiometryDifferent ratios than L2-II/IIIDifferent ratios than L2-I/IIIDifferent ratios than L2-I/II

This heterogeneity in virion morphology and genome packaging is unusual and suggests a complex assembly and genome encapsidation process that might involve the 66.6 kDa protein. Researchers interested in phage morphogenesis might investigate the role of specific proteins, including the 66.6 kDa protein, in determining which morphological form is produced .

What methods can be used to study the potential function of the uncharacterized 66.6 kDa protein?

To elucidate the function of the uncharacterized 66.6 kDa protein, researchers can employ several complementary approaches:

  • Bioinformatic analysis:

    • Sequence homology searches against known protein databases

    • Structural prediction using tools like AlphaFold or I-TASSER

    • Domain identification and functional prediction

    • Analysis of conserved motifs across related phages

  • Protein-protein interaction studies:

    • Pull-down assays using the recombinant His-tagged protein

    • Yeast two-hybrid screening with host proteins

    • Crosslinking studies followed by mass spectrometry

    • Co-immunoprecipitation with antibodies against the 66.6 kDa protein

  • Gene knockout/knockdown approaches:

    • CRISPR-Cas9 editing of the phage genome (if a system exists)

    • Antisense RNA targeting the ORF1 transcript

    • Expression of dominant-negative variants

  • Structural biology:

    • X-ray crystallography of the purified protein

    • Cryo-electron microscopy of the protein alone or in complex with binding partners

    • NMR spectroscopy for smaller domains

  • Proteomic approaches:

    • Mass spectrometry-based identification in infected cells (similar to approaches used for Salmonella phage SPN3US)

    • Temporal analysis of protein expression during infection

    • Post-translational modification analysis

The mass spectrometry approach used in the analysis of Salmonella phage SPN3US could be particularly valuable, as it identified 232 phage proteins during infection, representing 96% of the phage genome products . This comprehensive approach could help determine when the 66.6 kDa protein is expressed during infection and whether it undergoes processing or interacts with other viral or host proteins.

What are the physicochemical properties of Acholeplasma phage L2 virions relevant to experimental design?

Understanding the physicochemical properties of Acholeplasma phage L2 virions is essential for designing experiments involving virus propagation, purification, and functional analysis:

  • Temperature sensitivity:

    • Virions are extremely heat-sensitive

    • Relatively cold-stable

    • Experiments should avoid elevated temperatures during purification and storage

  • Chemical sensitivity:

    • Inactivated by nonionic detergents (Brij-58, Triton X-100, Nonidet P-40)

    • Susceptible to ether and chloroform treatment

    • Resistant to DNase I and phospholipase A

    • Sensitive to proteolytic enzymes (pronase and trypsin)

  • Radiation response:

    • UV-irradiated virions can be reactivated in host cells through excision and SOS DNA repair systems

    • Relatively resistant to photodynamic inactivation

  • Structural characteristics:

    • Lack of regular capsid structure

    • Asymmetric nucleoprotein condensation bounded by a lipid-protein membrane

    • Heterogeneous population with three distinct morphological forms

These properties should inform experimental design decisions, particularly for purification protocols (avoiding detergents, ether, chloroform, and proteases), storage conditions (cold storage), and functional assays. When designing experiments to study the 66.6 kDa protein, researchers should consider whether it contributes to any of these physicochemical properties, particularly the unusual heat sensitivity and detergent sensitivity that suggest a crucial role for lipid-protein interactions in virion integrity.

How can proteomics approaches be applied to study the role of the 66.6 kDa protein during infection?

Proteomic approaches offer powerful tools for understanding the temporal expression, localization, and interactions of the 66.6 kDa protein during Acholeplasma phage L2 infection:

  • Global proteomic profiling similar to that used for Salmonella phage SPN3US:

    • Infect Acholeplasma laidlawii cultures with phage L2

    • Collect samples at various timepoints post-infection

    • Process samples for liquid chromatography-tandem mass spectrometry (LC-MS/MS)

    • Analyze both phage and host proteins to track changes over time

    • Quantify relative abundance using spectral counts or isotope labeling

  • Protein-protein interaction network analysis:

    • Immunoprecipitate the 66.6 kDa protein from infected cells at different timepoints

    • Identify co-precipitating proteins by mass spectrometry

    • Construct temporal interaction networks to understand dynamic associations

  • Subcellular localization studies:

    • Fractionate infected cells into membrane, cytoplasmic, and nucleoid fractions

    • Analyze distribution of the 66.6 kDa protein in each fraction over time

    • Correlate localization with phage morphogenesis stages

  • Post-translational modification analysis:

    • Use phosphoproteomics, glycoproteomics, or other modification-specific approaches

    • Determine if the 66.6 kDa protein undergoes processing or modification during infection

    • Correlate modifications with protein function or virion assembly

  • Comparative analysis with mutant phages:

    • If available, compare proteomes of wild-type and mutant phages

    • Identify proteins whose abundance or modification state changes in response to mutations

    • Establish functional relationships between different phage proteins

The study of Salmonella phage SPN3US demonstrated that mass spectrometry can identify >90% of predicted phage proteins during infection. For Acholeplasma phage L2, this approach could help determine whether the 66.6 kDa protein is involved in DNA replication, transcription, or virion formation based on its temporal expression pattern and co-expression with proteins of known function .

What is the genomic context of the 66.6 kDa protein in Acholeplasma phage L2?

Understanding the genomic context of the gene encoding the 66.6 kDa protein provides important clues about its potential function:

The Acholeplasma phage L2 genome has the following characteristics:

  • Circular, superhelical dsDNA genome

  • 11,965 bp in size

  • G+C content of 32%

  • All ORFs encoded on one strand

  • Some genes translated from overlapping reading frames

The gene encoding the 66.6 kDa protein is designated as ORF 1 in the genome annotation, suggesting it may be located near the beginning of the genome. While the complete genomic context is not fully detailed in the provided search results, the table of ORFs shows that ORF 1 encodes a 66,643 Da protein, which aligns with the 66.6 kDa designation .

Notably, ORF 5 is annotated as a putative integrase, which is involved in the integration of temperate phage genomes into host chromosomes. The relative position of ORF 1 to this integrase gene could provide clues about the role of the 66.6 kDa protein in the phage life cycle .

A detailed analysis of the gene neighborhood and potential operonic structure would require examination of the full genome sequence and annotation, which could reveal functional relationships based on co-transcription or co-regulation patterns.

How might researchers design experiments to determine if the 66.6 kDa protein has enzymatic activity?

To investigate potential enzymatic activity of the Acholeplasma phage L2 66.6 kDa protein, researchers could implement the following experimental design:

  • Sequence-based predictions:

    • Analyze the amino acid sequence for known enzyme motifs or catalytic domains

    • Compare with structurally characterized enzymes from other phages

    • Identify potential active site residues for targeted mutagenesis

  • Generic enzymatic activity screening:

    • Test the purified recombinant protein against a panel of substrates for common enzymatic activities:

      • Nuclease activity (DNA/RNA degradation assays)

      • Protease activity (fluorogenic peptide substrates)

      • Polymerase activity (nucleotide incorporation assays)

      • ATPase/GTPase activity (phosphate release assays)

      • Kinase activity (phosphorylation assays)

  • Targeted activity assays based on infection context:

    • Test activities relevant to phage replication:

      • DNA binding assays (gel shift, fluorescence anisotropy)

      • Interaction with host cell membranes (liposome binding/disruption)

      • Host-specific protein interactions (pull-down with host extracts)

  • Structure-guided functional analysis:

    • Obtain structural information via X-ray crystallography or cryo-EM

    • Identify potential active sites or binding pockets

    • Design point mutations to disrupt potential catalytic residues

    • Test wild-type and mutant proteins for activity differences

  • In vivo complementation studies:

    • Determine if the protein can complement known enzymatic functions in model systems

    • Express in E. coli strains with mutations in essential enzymes

    • Assess ability to rescue growth or specific enzymatic defects

How does Acholeplasma phage L2 compare to other members of the Plasmaviridae family?

Acholeplasma phage L2 is the type species and currently the only well-characterized member of the Plasmaviridae family. According to the ICTV Ninth Report, the family description corresponds to the genus description because only one genus (Plasmavirus) is recognized .

  • Other mycoplasma phages: While not in the same family, phages that infect Mycoplasma species might share some features due to the similar cell wall-less nature of their hosts.

  • Other enveloped bacteriophages: Most bacteriophages are non-enveloped, making the enveloped nature of Acholeplasma phage L2 unusual. Comparison with other rare enveloped bacteriophages might reveal convergent adaptations.

  • Phages with pleomorphic morphology: The quasi-spherical, pleomorphic morphology of Acholeplasma phage L2 differs from the typical icosahedral or filamentous morphology of many bacteriophages. Comparing with other pleomorphic phages might reveal common structural principles.

The unique features of Acholeplasma phage L2, including its temperate lifecycle, enveloped structure, and infection of wall-less bacteria, suggest it occupies a specialized niche in phage biology. Further research to identify and characterize additional members of the Plasmaviridae family would enhance our understanding of their evolutionary relationships and genomic diversity .

What analytical techniques can be used to study the interaction between the 66.6 kDa protein and host Acholeplasma components?

To investigate interactions between the Acholeplasma phage L2 66.6 kDa protein and host Acholeplasma components, researchers can employ multiple complementary techniques:

  • Affinity-based approaches:

    • Pull-down assays using purified His-tagged 66.6 kDa protein and host cell lysates

    • Far-Western blotting with the recombinant protein as a probe against host proteins

    • Surface plasmon resonance (SPR) to measure binding kinetics with candidate host proteins

    • Bio-layer interferometry for real-time interaction analysis

  • Imaging techniques:

    • Immunofluorescence microscopy using antibodies against the 66.6 kDa protein to track localization during infection

    • Super-resolution microscopy to visualize co-localization with host structures

    • Correlative light and electron microscopy (CLEM) to connect protein localization with ultrastructural features

  • Crosslinking strategies:

    • In vivo chemical crosslinking followed by mass spectrometry (XL-MS)

    • Photo-activatable crosslinkers incorporated into the protein structure

    • Proximity labeling approaches like BioID or APEX to identify neighbors in the cellular context

  • Functional interference studies:

    • Blocking antibodies against the 66.6 kDa protein to disrupt specific interactions

    • Peptide inhibitors designed from interaction interfaces

    • Competition assays with fragments of the protein to identify binding domains

  • Genomic/transcriptomic approaches:

    • RNA-seq to identify host genes affected by overexpression of the 66.6 kDa protein

    • CRISPR screens in host cells to identify factors required for 66.6 kDa protein function

    • Transposon mutagenesis to identify host genes affecting phage replication

These approaches can help determine whether the 66.6 kDa protein interacts with host membranes (consistent with the enveloped nature of the phage), host DNA (suggesting a role in genome integration or replication), or specific host proteins (indicating a role in subverting host functions or recruiting host machinery) .

What are the specific challenges in working with Acholeplasma as a host system for phage studies?

Working with Acholeplasma as a host system for phage studies presents several unique challenges that researchers must address:

  • Culture conditions:

    • Acholeplasma species require rich, specialized media

    • As facultative anaerobes, they may require controlled atmospheric conditions

    • Growth rates are typically slower than conventional bacterial hosts like E. coli

    • Cell density monitoring is challenging due to the small cell size

  • Genetic manipulation limitations:

    • Fewer genetic tools are available compared to model bacteria

    • Transformation efficiencies may be lower

    • Limited selection markers for genetic modifications

    • Fewer characterized promoters and regulatory elements

  • Contamination concerns:

    • Wall-less nature makes them susceptible to osmotic stress

    • Potential for contamination with wall-possessing bacteria that can outgrow Acholeplasma

    • Mycoplasma detection requires specialized techniques

  • Phage propagation considerations:

    • The heat sensitivity of Acholeplasma phage L2 requires careful temperature control

    • Envelope-derived from host membranes adds complexity to purification

    • The three different morphological forms may have different infection efficiencies

  • Host diversity considerations:

    • Acholeplasma laidlawii genome analysis reveals unique features like the unusual duplication of rRNA operons

    • Comparative genomics with A. brassicae and A. palmae shows differences in metabolic capabilities that might affect phage replication

Understanding these challenges is essential for designing experiments that yield reproducible results. Researchers may need to adapt protocols developed for other phage-host systems, accounting for the unique biological properties of Acholeplasma and its phages .

How might the recombinant 66.6 kDa protein be used in structural biology applications?

The recombinant Acholeplasma phage L2 66.6 kDa protein offers several opportunities for structural biology investigations:

The availability of purified recombinant protein with >90% purity makes these approaches feasible. The N-terminal His tag facilitates purification but may affect structure; researchers should consider tag removal using specific proteases before structural studies. Additionally, the lyophilized form of the commercially available protein requires careful reconstitution to maintain structural integrity .

How can researchers interpret mass spectrometry data to understand the role of the 66.6 kDa protein in phage infection?

Interpreting mass spectrometry data for understanding the 66.6 kDa protein's role in Acholeplasma phage L2 infection requires a systematic analytical approach:

  • Temporal expression profiling:

    • Collect samples at multiple timepoints during infection

    • Quantify relative abundance of the 66.6 kDa protein across timepoints

    • Cluster proteins with similar expression patterns

    • Identify whether the protein is expressed early (potential role in host takeover), middle (potential role in DNA replication), or late (potential structural role)

  • Protein-protein interaction network analysis:

    • Identify proteins co-purifying with the 66.6 kDa protein

    • Build interaction networks at different infection stages

    • Apply network analysis algorithms to identify key hubs and modules

    • Compare with known phage protein interaction networks

  • Post-translational modification mapping:

    • Identify modified peptides using specialization identification algorithms

    • Map modifications to specific residues

    • Determine if modifications change during infection

    • Correlate modifications with protein function or location

  • Comparative analysis with related phages:

    • Compare proteomics data with studies on other phages (like SPN3US)

    • Identify functional analogs even in the absence of sequence homology

    • Look for conservation of expression patterns or interaction networks

  • Integration with genomic and transcriptomic data:

    • Correlate protein abundance with transcript levels

    • Identify potential regulatory mechanisms

    • Compare with protein predictions from genomic data

The approach used for Salmonella phage SPN3US, which identified 232 phage proteins in infected cells representing 96% of the genome, provides an excellent methodological template. That study demonstrated how mass spectral counts can reveal the most abundant proteins and provide insights into their functions - for instance, identifying a candidate scaffold protein based on its high abundance in infected cells but absence from mature virions .

What are the challenges in functionally characterizing an "uncharacterized" phage protein like the 66.6 kDa protein?

Functional characterization of uncharacterized phage proteins like the Acholeplasma phage L2 66.6 kDa protein presents several significant challenges:

  • Limited homology and annotation:

    • Phage proteins often lack significant sequence similarity to characterized proteins

    • Standard homology-based annotation tools may fail to assign functions

    • Phage-specific protein families may be underrepresented in databases

  • Complex viral-host interactions:

    • Functions may be context-dependent, requiring the host cellular environment

    • Proteins may have different functions at different stages of infection

    • Interactions with host factors may be species-specific and difficult to recapitulate in vitro

  • Multifunctional nature:

    • Phage proteins often perform multiple roles due to genome size constraints

    • Different domains may have distinct functions

    • Functions may change depending on processing, oligomerization, or modification state

  • Technical limitations:

    • Difficulty in genetic manipulation of some phage systems

    • Challenges in expressing toxic or insoluble phage proteins

    • Limited availability of antibodies or other specific reagents

  • Phage-specific structures:

    • Unusual structural features not commonly found in cellular proteins

    • Novel folds or assemblies that are difficult to predict computationally

    • Complex integration into virion structures

The experience with Salmonella phage SPN3US, which has 264 gene products with many functionally uncharacterized, highlights this challenge. In that case, mass spectrometry helped identify a candidate scaffold protein based on its abundance pattern during infection versus mature virions, demonstrating how indirect evidence can provide functional insights for uncharacterized proteins .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.