Recombinant Acholeplasma phage L2 Uncharacterized 81.3 kDa protein

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Acholeplasma Phage L2 Uncharacterized kDa Protein

The "Recombinant Acholeplasma phage L2 Uncharacterized 81.3 kDa protein" refers to a protein derived from the Acholeplasma phage L2, with a molecular weight of approximately 81.3 kDa, and its function is not yet fully understood . Acholeplasma phage L2 is a virus that infects Acholeplasma laidlawii, a bacterium belonging to the class Mollicutes . The phage L2 genome consists of 11,965 base pairs with a G+C content of 32% . The genome encodes several open reading frames (ORFs), including ORF13, which corresponds to the 81.3 kDa protein .

Genomic Context

The Acholeplasma phage L2 genome contains 15 ORFs . ORF13 codes for a protein of 81,308 Da, identified as a putative integral membrane protein . This protein has a 27 amino acid N-terminal peptidase cleavage signal sequence, suggesting it is integrated into the membrane . There is a second possible translation start site within ORF13, 295 codons downstream, which would produce a protein of 47,699 Da .

Table 1: Acholeplasma Phage L2 ORFs

ORFSize (Da)Description
ORF 166,643
ORF 29,620
ORF 337,157
ORF 418,224
ORF 534,868Putative integrase, gene is upstream from
ORF 69,799
ORF 714,047
ORF 87,412
ORF 99,332
ORF 1016,143
ORF 1125,562
ORF 1217,214Basic protein, putative major virion DNA-binding protein
ORF 1381,308Putative integral membrane protein, has 27 amino acid N-terminal peptidase cleavage signal sequence
ORF 13*47,699Translation start site is 295 codons downstream from ORF13 start site and in same reading frame
ORF 1426,105Has 26 aa N-terminal peptidase cleavage signal sequence

Role in Viral Infection and Replication

Acholeplasma phage L2 exhibits a non-cytocidal productive infectious cycle followed by a lysogenic cycle in infected cells . During the non-cytocidal infection, the phages are released by budding from the host cell membrane, allowing the host cell to survive as a lysogen . Lysogeny involves the integration of the phage L2 genome into the host cell chromosome at a specific site . The 81.3 kDa protein, potentially being an integral membrane protein, might play a role in the budding process or in maintaining the integrity of the host cell membrane during phage release .

Recombinant Production

Recombinant proteins are produced using genetic engineering techniques, where the gene encoding the protein of interest is inserted into a host organism (e.g., bacteria, yeast, or mammalian cells), which then produces the protein . The "Recombinant" prefix indicates that this 81.3 kDa protein has been produced using such methods, likely for research purposes such as structural studies, functional assays, or antibody development .

Biotechnological and Therapeutic Potential

While the specific function of the 81.3 kDa protein is uncharacterized, phages and phage-derived proteins have a range of biotechnological and therapeutic applications . Phages can be used in phage therapy to target and kill specific bacteria, including those resistant to antibiotics . Phage-derived proteins can be used as antimicrobial agents or as tools for drug delivery . Further research into the 81.3 kDa protein might reveal novel functions or applications in these areas.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes. We will accommodate your request whenever possible.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C. Lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
Uncharacterized 81.3 kDa protein; ORF13
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
28-738
Protein Length
Full Length of Mature Protein
Species
Acholeplasma phage L2 (Bacteriophage L2)
Target Protein Sequence
YEETETFTFEIYNMNSVVANPGLYNYLVDLTDGYGYGQMQHVTVDISLLDYNTAYLEKNL NGFNLFFTSDTGVYEFGIDASGNIELLNDPVAHDEYSLTFTGLNNAYQDLFYEEIVVEFE IVSFDSLEGVGTLDPNPYVVLSELLTENYEYNETIAPFIWVNDVQYQNYYSVYDIGSDLA LIEIDGPTLNIYSDRFEEYNETFDVGDEFRIIFKIYKTWTQAHDYGRIRTNASTLYLNQQ SDTSALLSHSESTNVINVNNIAVGDEIVMQSPYTDFSVSYGNVGFPRTYLVEQENIAAVK MIKNSSDNTNYTFILFYWENGSVVSRTVNNINLANRNSLNIKFDGGFRKALNYSDVMVAN VDLLTPLEDFLPNMVAWDAIDGDISDSIVITDNDGYSPDTVGIYNVEFSVTNSNGQTSSI IAPVHVVDIVNPVINGVSDTVHISYDQTFNVTNWVNSLTVSDNYYTGLSISIKENTYTVN KNKLGTYKITVQAVDPSGNIGTLTRTIVVNDGIGPVFNGINTITASINENITVEQIKAGL AAIDAIDGNVTTSIVVDSDNLTGKANTVGVYEVVFRAVDAAGNQTFHTVTVSIVASPPGF YILNSNSVRLLPGANLTIEQILNILNASDAENISTNYTVSVPGTYNLSFTLYGESHQVSI TVLGQNDSIIPTPVIPGESNPGFNITYALIIGLSAIALLATTVTILNKKRK
Uniprot No.

Target Background

Database Links

KEGG: vg:1261017

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Acholeplasma phage L2 and its taxonomic classification?

Acholeplasma phage L2 is the type species of the genus Plasmavirus within the Plasmaviridae family of bacteriophages. It is a unique virus that infects Acholeplasma bacteria, a genus of wall-less prokaryotes. The taxonomic significance of this phage is notable as it represents the sole characterized member of the Plasmaviridae family in the International Committee on Taxonomy of Viruses (ICTV) classification .

Unlike most bacteriophages, Acholeplasma phage L2 displays unusual morphological and life cycle characteristics. It is a pleomorphic, membrane-containing phage that follows a lysogenic lifecycle, integrating its genome into the host chromosome rather than causing immediate lysis .

What are the structural characteristics of Acholeplasma phage L2 virions?

Acholeplasma phage L2 virions exhibit several distinctive structural features:

  • Morphology: Quasi-spherical, slightly pleomorphic, and enveloped particles

  • Size: Approximately 80 nm in diameter (range 50-125 nm)

  • Structure: Lacks a regular capsid structure, suggesting an asymmetric nucleoprotein condensation bounded by a lipid-protein membrane

  • Heterogeneity: At least three distinct virion forms are produced during infection

  • Internal organization: Thin-sections reveal virions with densely stained centers (presumably containing condensed DNA) and particles with lucent centers

This unique morphology distinguishes Acholeplasma phage L2 from other bacteriophages, particularly the more common head-tail structured phages.

What is known about the genome organization of Acholeplasma phage L2?

The Acholeplasma phage L2 genome has several notable features:

  • Genome type: Circular, superhelical double-stranded DNA

  • Size: 11,965 base pairs

  • G+C content: 32%

  • Coding strategy: All ORFs are encoded in one strand

  • Gene organization: Several genes are translated from overlapping reading frames

  • Number of ORFs: 15 identified open reading frames

Table 1. Identified ORFs in Acholeplasma phage L2 genome

ORFMolecular Weight (Da)Known or Putative Function
ORF 166,643Uncharacterized
ORF 29,620Uncharacterized
ORF 337,157Uncharacterized
ORF 418,224Uncharacterized
ORF 534,868Putative integrase
ORF 69,799Uncharacterized
ORF 714,047Uncharacterized
ORF 87,412Uncharacterized
ORF 99,332Uncharacterized
ORF 1016,143Uncharacterized
ORF 1125,500*Uncharacterized
*Value truncated in source data

What is currently known about the uncharacterized 81.3 kDa protein?

The 81.3 kDa protein from Acholeplasma phage L2 remains largely uncharacterized, as suggested by its name. Based on available information:

  • Expression system: Successfully expressed in E. coli as a recombinant protein

  • Tag modification: Available with His-tag for purification purposes

  • Mature protein: Spans amino acids 28-738

  • Structure: No crystal or solution structure has been determined

  • Function: Biological role remains undefined

This protein is likely one of the largest encoded by the Acholeplasma phage L2 genome, as most of the identified ORFs encode smaller proteins. Given its size, it may play a structural role in the virion or serve as an enzyme involved in viral replication or integration.

How does this protein potentially relate to the four major virion proteins?

Virions of Acholeplasma phage L2 contain at least four major proteins with molecular weights of approximately 64, 61, 58, and 19 kDa, along with several minor proteins . The uncharacterized 81.3 kDa protein, given its size, is not among these four major virion proteins. This suggests several possibilities:

  • It may be present in low abundance as one of the minor virion proteins

  • It might be a non-structural protein involved in replication, transcription, or genome packaging

  • It could be a precursor protein that undergoes post-translational processing

  • It may be involved in host-virus interactions rather than virion structure

Methodological investigation using mass spectrometry of purified virions, followed by comparison with recombinant protein fragmentation patterns, would be necessary to determine if the protein is present in mature virions.

What expression and purification strategies are recommended for this recombinant protein?

For optimal expression and purification of the recombinant Acholeplasma phage L2 uncharacterized 81.3 kDa protein:

  • Expression system selection:

    • E. coli has been successfully used to express this protein

    • Consider BL21(DE3) or other strains optimized for large protein expression

    • Use codon-optimized constructs to account for the different G+C content (32% in phage vs. ~50% in E. coli)

  • Expression conditions optimization:

    • Test multiple induction temperatures (16°C, 25°C, 30°C, 37°C)

    • Vary IPTG concentrations (0.1-1.0 mM)

    • Consider autoinduction media for higher yields of soluble protein

    • Include solubility enhancers like sorbitol or betaine in growth media

  • Purification protocol:

    • Immobilized metal affinity chromatography (IMAC) using the His-tag

    • Size exclusion chromatography as a second purification step

    • Consider ion exchange chromatography if additional purity is required

    • Optimize buffer conditions to maintain protein stability (pH, salt concentration, reducing agents)

  • Quality control:

    • SDS-PAGE analysis to verify size and purity

    • Western blotting with anti-His antibodies

    • Mass spectrometry to confirm protein identity

    • Dynamic light scattering to assess homogeneity

What biophysical methods would be most informative for structural characterization?

For comprehensive structural characterization of this uncharacterized protein:

  • Secondary structure analysis:

    • Circular dichroism (CD) spectroscopy to determine α-helix and β-sheet content

    • Fourier-transform infrared spectroscopy (FTIR) as a complementary method

  • Tertiary structure determination:

    • X-ray crystallography (requires successful crystallization)

    • Cryo-electron microscopy (particularly if the protein forms complexes)

    • Nuclear magnetic resonance (NMR) for domain analysis

    • Small-angle X-ray scattering (SAXS) for solution structure and flexibility assessment

  • Stability and conformational studies:

    • Differential scanning calorimetry (DSC) and differential scanning fluorimetry (DSF)

    • Limited proteolysis combined with mass spectrometry to identify domains

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS)

  • Protein dynamics:

    • Molecular dynamics simulations based on predicted structures

    • Single-molecule FRET if studying interactions with other components

How should researchers approach functional characterization of this protein?

To systematically investigate the function of this uncharacterized protein:

  • Bioinformatic analysis:

    • Protein sequence homology searches against known proteins

    • Domain and motif prediction using tools like PFAM, PROSITE, and InterPro

    • Structural homology modeling and comparison with characterized proteins

    • Phylogenetic analysis across related phages

  • Molecular and cellular studies:

    • Gene knockout or disruption to assess essentiality

    • Protein localization during infection using fluorescent tagging

    • Co-immunoprecipitation to identify interacting partners

    • Chromatin immunoprecipitation if DNA-binding function is suspected

  • Biochemical activity assays:

    • ATPase/GTPase activity tests

    • Nucleic acid binding assays

    • Protease or other enzymatic activity screens

    • Protein-protein interaction assays (yeast two-hybrid, pull-down assays)

  • Structural biology approach:

    • Solve the protein structure and compare with known structural motifs

    • Use structure-guided mutagenesis to test functional hypotheses

    • Identify potential active sites or binding pockets

How does Acholeplasma phage L2 compare to other membrane-containing bacteriophages?

Acholeplasma phage L2 represents a unique type among membrane-containing bacteriophages:

FeaturePlasmaviridae (Acholeplasma phage L2)TectiviridaeCorticoviridaeCystoviridae
MorphologyPleomorphic, envelopedIcosahedral, internal membraneIcosahedral, internal membraneEnveloped
Virion diameter~80 nm~55-80 nm~55-130 nm~50-85 nm
GenomedsDNA, circulardsDNA, lineardsDNA, circulardsRNA, segmented
Life cycleLysogenicLytic or LysogenicLytic or LysogenicLytic
Release mechanismBudding through membraneCell lysisCell lysisCell lysis

Unlike other membrane-containing phages like PRD1 (Tectiviridae) and PM2 (Corticoviridae), Acholeplasma phage L2 lacks an icosahedral capsid structure. Instead, it possesses a pleomorphic morphology with a more flexible arrangement of proteins and lipids .

While members of the PRD1-adenovirus lineage (including Tectiviridae and Corticoviridae) feature major capsid proteins with double β-barrel folds or similar architectural elements, the structural proteins of Acholeplasma phage L2 remain largely uncharacterized .

What is the evolutionary significance of Plasmaviridae bacteriophages?

Plasmaviridae represents a unique evolutionary branch among bacteriophages with several noteworthy characteristics:

  • Unique morphology: The pleomorphic, membrane-bound structure without a defined capsid differs significantly from the majority of characterized bacteriophages, suggesting a distinct evolutionary pathway .

  • Host specificity: Infection of Acholeplasma, a genus of wall-less bacteria, may indicate adaptation to a specialized ecological niche .

  • Lifecycle: The non-lytic, budding release mechanism resembles that of some enveloped eukaryotic viruses more than typical bacteriophage lysis strategies .

  • Limited diversity: Currently, Acholeplasma phage L2 is the only well-characterized member of this family, suggesting either limited distribution or sampling bias in phage research .

Understanding proteins like the 81.3 kDa uncharacterized protein could provide insights into the evolutionary relationships between Plasmaviridae and other virus families, potentially revealing novel mechanisms of virus-host interactions.

What challenges might researchers encounter when working with proteins from Acholeplasma phage L2?

Researchers working with proteins from Acholeplasma phage L2, including the uncharacterized 81.3 kDa protein, may face several challenges:

  • Limited reference data: As an understudied phage, there is minimal published information about protein functions, optimal conditions, or experimental protocols .

  • Expression difficulties: Larger viral proteins may exhibit folding issues or toxicity when expressed in heterologous systems. Strategies to address this include:

    • Testing multiple expression strains

    • Using tightly controlled inducible promoters

    • Expression as fusion proteins with solubility-enhancing partners

    • In vitro translation systems

  • Structural determination challenges: Without known homologs or functional predictions, structure determination may require multiple approaches:

    • Divide the protein into domains for separate analysis

    • Use integrative structural biology combining multiple techniques

    • Apply hydrogen-deuterium exchange mass spectrometry to identify structured regions

  • Functional assay development: Without predicted function, designing appropriate assays requires systematic exploration:

    • Broad-spectrum activity assays

    • Testing interaction with multiple cellular components

    • In vitro reconstitution of potential virus assembly intermediates

How can researchers distinguish between viral and host proteins when studying Acholeplasma phage L2?

When investigating Acholeplasma phage L2 proteins during infection:

  • Comparative proteomics approach:

    • Compare proteome profiles of infected vs. uninfected cells at multiple time points

    • Identify proteins unique to infected cells

    • Correlate with viral genome sequence predictions

  • Isotope labeling strategies:

    • SILAC (Stable Isotope Labeling with Amino acids in Cell culture)

    • Pulse-chase experiments to track newly synthesized proteins

    • N15 labeling of host or virus

  • Genetic approaches:

    • Expression of tagged viral proteins for specific detection

    • Creation of reporter fusions to monitor expression patterns

    • Genome-wide CRISPR screening to identify host factors

  • Bioinformatic discrimination:

    • Codon usage analysis (viral genes often have distinctive codon bias)

    • G+C content analysis (32% for phage L2 vs. typically different for host)

    • Phylogenetic profiling against known viral and bacterial proteins

How might this protein be utilized in comparative virology studies?

The uncharacterized 81.3 kDa protein presents opportunities for advancing comparative virology through:

  • Structural classification:

    • Determining if this protein contains novel folds not present in other phage lineages

    • Identifying potential evolutionary relationships with proteins from other virus families

    • Contributing to structure-based viral classification systems

  • Comparative functional analysis:

    • Identifying functional analogs in other viruses despite sequence divergence

    • Uncovering convergent evolution in viral mechanisms

    • Exploring the diversity of protein functions within membrane-containing phages

  • Host-range determinant studies:

    • Investigating whether this protein contributes to host specificity

    • Comparing with proteins from phages infecting related bacterial hosts

    • Examining adaptations specific to wall-less bacterial hosts

  • Viral assembly mechanism research:

    • Comparing assembly pathways between different membrane-containing phage groups

    • Investigating the role of large proteins in viral morphogenesis

    • Exploring evolutionary conservation of virus assembly mechanisms

What hypotheses regarding protein function can be developed based on current knowledge of Plasmaviridae?

Based on the available information about Acholeplasma phage L2 lifecycle and structure, several hypotheses about the 81.3 kDa protein's function can be formulated:

  • Integration/excision hypothesis: Given the lysogenic lifecycle, this protein might function as a recombinase or assist the putative integrase (ORF 5) in site-specific recombination .

  • Membrane interaction hypothesis: The protein might facilitate the unusual budding release mechanism by modifying host membranes or coordinating virion assembly at membrane sites .

  • Structural scaffolding hypothesis: It could function as a scaffolding protein during virion assembly, particularly given the pleomorphic nature of the virus particles .

  • Regulatory hypothesis: The protein might regulate the transition between lysogeny and the lytic cycle, responding to environmental signals.

  • Host modification hypothesis: It could alter host cell processes to favor viral replication or persistence, particularly given the non-lytic nature of the viral lifecycle.

Each hypothesis generates testable predictions, such as localization patterns, interaction partners, enzymatic activities, or phenotypic changes upon mutation or deletion.

What strategies can resolve solubility issues when expressing the recombinant protein?

If encountering solubility problems with the recombinant 81.3 kDa protein:

  • Optimization of expression conditions:

    • Lower the expression temperature (16-20°C)

    • Reduce inducer concentration

    • Use auto-induction media for slower protein production

    • Co-express with molecular chaperones (GroEL/GroES, DnaK/DnaJ)

  • Protein engineering approaches:

    • Express individual domains separately

    • Create fusion constructs with highly soluble partners (MBP, SUMO, TRX)

    • Identify and modify aggregation-prone regions

    • Introduce solubility-enhancing mutations based on homology modeling

  • Buffer optimization:

    • Screen different pH conditions (typically pH 6.0-8.5)

    • Test various salt concentrations (100-500 mM NaCl)

    • Include stabilizing additives (glycerol, arginine, trehalose)

    • Add mild detergents if membrane association is suspected

  • Extraction protocols:

    • If in inclusion bodies, develop a refolding protocol

    • Test enzymatic cell lysis instead of sonication

    • Consider native purification methods under non-denaturing conditions

How can researchers differentiate between specific and non-specific activities when characterizing this protein?

To establish confidence in observed functional activities:

  • Implement rigorous controls:

    • Use denatured protein preparations as negative controls

    • Include unrelated proteins of similar size/properties

    • Create site-directed mutants for suspected active sites

    • Perform dose-response experiments

  • Validation through multiple techniques:

    • Confirm activity using orthogonal assay methods

    • Correlate in vitro findings with in vivo effects

    • Demonstrate consistency across different protein preparations

    • Cross-validate with genetic approaches (knockouts, complementation)

  • Specificity determination:

    • Determine kinetic parameters (Km, kcat) if enzymatic

    • Measure binding affinities for potential interactors

    • Compete with potential natural substrates

    • Map binding/activity domains through truncation or mutation

  • Contextual validation:

    • Test activity under physiologically relevant conditions

    • Compare activity in the presence of other viral components

    • Determine if the activity is conserved in related viruses

    • Correlate activity with specific stages of the viral lifecycle

By applying these methodological approaches, researchers can develop a comprehensive understanding of the uncharacterized 81.3 kDa protein from Acholeplasma phage L2, potentially revealing new insights into the biology and evolution of membrane-containing bacteriophages.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.