Recombinant Acidaminococcus fermentans Protein translocase subunit SecF (secF)

Shipped with Ice Packs
In Stock

Description

Structure and Functional Role

SecF is a multi-pass transmembrane protein belonging to the SecD/SecF family. It interacts with SecD to form the SecDF complex, which associates with the SecYEG preprotein-conducting channel. This complex harnesses the proton motive force (PMF) to drive the translocation of nascent polypeptides after the ATP-dependent SecA-mediated initiation phase .

Key structural features include:

  • Transmembrane Helices: SecF contains multiple hydrophobic regions, enabling its integration into the inner membrane .

  • Interactions: SecDF stabilizes the SecYEG channel and facilitates the late stages of protein translocation .

Recombinant Production and Characteristics

Recombinant SecF proteins are produced for structural and functional studies. Key details include:

ParameterValue/DescriptionSource
Expression SystemEscherichia coli (His-tagged)
Purity>90% (SDS-PAGE)
TagN-terminal His-tag (1–471aa) or variable tags (e.g., undefined in partial constructs)
ApplicationsSDS-PAGE analysis, ELISA, structural studies
UniProt IDD2RLC7
Gene LocusAcfer_1521

Discrepancies in protein length (e.g., 293aa vs. 471aa) arise from construct design variations, with full-length versions retaining functional domains .

Mechanistic Studies

SecF’s role in the Sec translocase has been studied in heterologous systems:

  • Protein Secretion Enhancement: Overexpression of secF in Lactococcus lactis improves recombinant protein secretion, highlighting its potential in biotechnology .

  • Electron Transfer Dynamics: While not directly involving SecF, electron-transferring flavoproteins (ETFs) in A. fermentans demonstrate energy coupling mechanisms relevant to membrane protein function .

Comparative Data: Recombinant SecF Variants

VariantTagLengthPuritySource
Full-length (1–471aa)N-terminal His471aa>90%
Partial (1–293aa)Undetermined293aa>85%
E. coli-expressedHis-tagVariable>90%

Significance in Biotechnology

The recombinant SecF protein serves as a model for optimizing protein secretion systems. Its study informs:

  • Industrial Strain Engineering: Improving yield of therapeutic proteins in Gram-positive hosts .

  • Membrane Protein Dynamics: Understanding energy coupling in translocation processes .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
secF; Acfer_1521; Protein translocase subunit SecF
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-293
Protein Length
full length protein
Species
Acidaminococcus fermentans (strain ATCC 25085 / DSM 20731 / VR4)
Target Names
secF
Target Protein Sequence
MKKFSIVKHARIFFSITAVVLIVGIVSMFARGFNLGIDFTGGSILDIKFDQPVTVAQVRT VLSDHQLGSSVIQLGSSDQQVESSQSVLIRTGLISDSQRVDVMNDLSNRLGHNEVLRVEN VGATVGGDLVKSAVGAVVLSWVLMIIYITIRFELRFALAAIVALIIDVMVTLTWFSVLHL EIDSSFVAALLTVVGYSVNGTIVVFDRIRENLHTHRRNESMGDLVDASIWQTMTRSVYTT LTTLFAVVAIFLFGGETIHNFSFAMLVGFCSGFYTSTFLAGSMWLFFRKKLKR
Uniprot No.

Target Background

Function

SecF is a component of the Sec protein translocase complex. It interacts with the SecYEG preprotein conducting channel. SecDF utilizes the proton motive force (PMF) to complete protein translocation following the ATP-dependent action of SecA.

Database Links
Protein Families
SecD/SecF family, SecF subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Acidaminococcus fermentans and why is it significant for SecF research?

Acidaminococcus fermentans is the type species of the genus Acidaminococcus and belongs to the Firmicutes phylum. Originally isolated from a pig alimentary tract, this organism has been found in humans and cow rumen, indicating its widespread presence in the gastrointestinal tract of various homeothermic animals . A. fermentans is metabolically distinctive, capable of using amino acids as the sole source of energy for anaerobic growth, primarily through glutamate fermentation via the 2-hydroxyglutarate pathway .

The significance of studying SecF in A. fermentans lies in understanding how protein translocation systems function in the context of specialized metabolic pathways. A. fermentans utilizes a sodium motive force for membrane energetics in the transport and catabolism of substrates , which may influence how the Sec system, including SecF, has adapted in this organism. Research on A. fermentans SecF can provide valuable insights into:

  • Adaptation of protein secretion systems in anaerobic gut bacteria

  • Evolutionary specialization of essential cellular machinery

  • Structure-function relationships in SecF proteins from metabolically specialized organisms

  • Protein translocation mechanisms supporting unique metabolic capabilities

What are the general structural characteristics and functions of bacterial SecF proteins?

The SecF protein is an integral membrane component of the bacterial protein translocation machinery. As part of the Sec system, it plays crucial roles in:

  • Enhancing the efficiency of protein translocation across the cytoplasmic membrane

  • Preventing backsliding of partially translocated proteins

  • Assisting in the release of proteins on the periplasmic side of the membrane

  • Contributing to the maintenance of the ion motive force needed for translocation

Table 1: Key Structural Features of Bacterial SecF Proteins

Structural FeatureTypical CharacteristicsFunctional Significance
Transmembrane domains6 transmembrane segmentsMembrane anchoring and channel formation
Periplasmic domainsLarge domain between TM segments 4-5Substrate interaction and processing
Conserved charged residuesDistributed in TM and periplasmic regionsIon coupling and protein interaction
SecD associationForms complex with SecDEnhanced translocation efficiency
YajC interactionOften associates with SecDFStabilization of the complex

In A. fermentans, the SecF protein would be expected to maintain these core features while potentially exhibiting adaptations related to the organism's specialized metabolism and environment.

How does the cellular context of A. fermentans likely influence SecF function?

Based on the known characteristics of A. fermentans, several factors likely influence SecF function in this organism:

  • Sodium-dependent energetics: A. fermentans utilizes a sodium motive force for membrane energetics rather than solely relying on proton gradients . This may result in adaptations in the SecF protein to couple translocation to sodium gradients.

  • Specialized metabolism: A. fermentans thrives through glutamate fermentation and trans-aconitate utilization . SecF would be crucial for the secretion of extracellular enzymes involved in these pathways.

  • Anaerobic environment: As an obligate anaerobe residing in the gut, A. fermentans SecF would function in a consistently low-oxygen environment, potentially influencing protein folding and stability.

  • Membrane composition: A. fermentans contains specific phospholipids including disphosphatidylglycerol, phosphatidylethanolamine, and possibly phosphatidylcholine . The SecF protein would be adapted to function optimally within this lipid environment.

  • Cell wall structure: Despite being classified as Gram-negative morphologically, A. fermentans belongs to the predominantly Gram-positive Firmicutes phylum , suggesting potential unique cell envelope properties that may influence protein translocation.

What are the optimal expression systems for recombinant A. fermentans SecF protein?

Table 2: Recommended Expression Systems for Recombinant A. fermentans SecF

Expression SystemAdvantagesLimitationsOptimization Strategies
E. coli C41/C43(DE3)Specialized for toxic membrane proteinsPossible codon usage issuesGrowth at 16-20°C, induction with 0.1-0.5 mM IPTG
E. coli Lemo21(DE3)Tunable expression levelLower yields than specialized strainsTitration of L-rhamnose for expression control
Bacillus subtilisCloser phylogenetic relation to A. fermentansDifferent secretion stress responseUse of controlled promoters (e.g., PxylA)
Cell-free systemsAvoids toxicity issuesHigher cost, lower scalabilityAddition of liposomes or nanodiscs

Key considerations for optimizing expression include:

  • Codon optimization: Analysis of A. fermentans codon usage patterns to enhance expression in heterologous hosts.

  • Fusion partners: Strategic use of fusion tags such as MBP or SUMO to enhance solubility, with a specific protease cleavage site for tag removal.

  • Temperature modulation: Lower expression temperatures (16-20°C) to facilitate proper folding of this complex membrane protein.

  • Induction conditions: Gentle induction with lower concentrations of inducers over extended periods.

  • Medium supplementation: Addition of specific lipids found in A. fermentans membranes may aid proper folding and stability.

What purification strategies are most effective for isolating functional A. fermentans SecF?

Purification of membrane proteins like SecF requires specialized approaches:

Table 3: Systematic Purification Strategy for A. fermentans SecF

Purification StageRecommended TechniqueCritical ParametersExpected Outcomes
Membrane isolationDifferential ultracentrifugation100,000 × g, 1 hour, 4°CEnriched membrane fraction
SolubilizationDetergent extraction1-2% DDM or LMNG, 1 hour, 4°CSolubilized SecF
Primary purificationIMAC (for His-tagged protein)20-50 mM imidazole wash75-85% purity
Secondary purificationSize exclusion chromatographyFlow rate: 0.5 mL/min>90% purity
Stability enhancementAddition of lipids0.1-0.2 mg lipid/mg proteinFunctional protein

Critical considerations for maintaining functional protein during purification:

  • Buffer composition: Inclusion of glycerol (10-15%) and reducing agents to stabilize the protein.

  • Detergent selection: Screening multiple detergents (DDM, LMNG, CHAPS) for optimal solubilization while maintaining function.

  • Lipid supplementation: Addition of specific phospholipids found in A. fermentans membranes (phosphatidylethanolamine, disphosphatidylglycerol) .

  • Protease inhibition: Comprehensive protease inhibitor cocktails to prevent degradation.

  • Quality control: Verification of protein folding using circular dichroism and homogeneity via analytical ultracentrifugation.

How can researchers develop reliable activity assays for A. fermentans SecF?

Functional characterization of SecF requires specialized assays:

Table 4: Functional Assays for A. fermentans SecF

Assay TypeMethodologyReadoutControls Required
ATPase stimulationSecA ATPase activity enhancementPhosphate releaseSecA alone, inactive SecF
Protein translocationReconstituted system with SecYEGTransported substrateLiposomes without SecF
Proton/sodium transportpH-sensitive fluorophoresFluorescence changeProtonophore/sodium ionophore
Complex formationNative PAGE or gel filtrationComplex assemblyIndividual components
ThermostabilityDifferential scanning fluorimetryMelting temperatureWell-characterized membrane proteins

For developing reliable assays, researchers should:

  • Identify native A. fermentans substrates by analyzing the secretome of this organism.

  • Design reporter constructs containing A. fermentans signal sequences fused to easily detectable proteins.

  • Incorporate the sodium dependency of A. fermentans membrane energetics into assay design.

  • Establish liposome compositions that mimic the native membrane environment of A. fermentans.

  • Develop appropriate negative controls through site-directed mutagenesis of conserved SecF residues.

How should researchers analyze conformational dynamics of A. fermentans SecF?

Analyzing the conformational dynamics of SecF requires multiple complementary approaches:

  • Computational methods:

    • Molecular dynamics simulations to explore conformational states

    • Normal mode analysis to identify major motions

    • Homology modeling based on existing SecF structures

    • Energy landscape calculations to identify stable conformations

  • Experimental approaches:

    • Hydrogen-deuterium exchange mass spectrometry to identify flexible regions

    • Site-directed spin labeling with EPR to measure distances between domains

    • Single-molecule FRET to observe dynamics in real-time

    • Crosslinking studies to capture specific conformational states

  • Data integration strategies:

    • Correlation of functional data with structural information

    • Integration of dynamics data across multiple timescales

    • Comparison with SecF dynamics from model organisms

    • Statistical analysis of ensemble measurements

When interpreting conformational dynamics data, researchers should consider the sodium-dependent energetics of A. fermentans and how this might influence SecF conformational states compared to proton-dependent systems in model organisms.

What statistical approaches are most appropriate for analyzing variability in SecF expression and function?

Table 5: Statistical Methods for SecF Research Data Analysis

Data TypeRecommended Statistical MethodApplicationConsiderations
Expression optimizationFactorial design of experimentsIdentify optimal conditionsInclude interactions between factors
Purification yieldMultiple regression analysisPredict yields based on conditionsTransformation may be needed for normality
Activity assaysANOVA with post-hoc testsCompare multiple variants or conditionsCheck assumptions of normality
Kinetic parametersNon-linear regressionDetermine mechanistic constantsSelect appropriate kinetic model
Stability measurementsSurvival analysisAnalyze time-to-denaturationCan handle right-censored data
Structure-functionMachine learning approachesPredict function from sequenceRequires sufficient training data

Key considerations for robust statistical analysis:

  • Power analysis to determine appropriate sample sizes for detecting biologically meaningful differences.

  • Appropriate handling of batch effects through mixed models or blocking designs.

  • Validation of statistical assumptions for each test using appropriate diagnostic plots.

  • Correction for multiple comparisons when conducting numerous hypothesis tests.

  • Use of bootstrapping or permutation tests when parametric assumptions are violated.

How can researchers address contradictory findings about SecF function when comparing A. fermentans to other species?

When confronted with contradictory findings across species:

  • Methodological standardization:

    • Implement identical experimental protocols across species

    • Use the same expression systems and purification methods

    • Standardize activity assay conditions and readouts

    • Ensure comparable protein quality and purity

  • Contextual analysis:

    • Consider differences in native membrane environments

    • Account for the sodium-dependent energetics of A. fermentans

    • Analyze phylogenetic relationships between compared species

    • Examine the metabolic context of each organism

  • Direct comparative studies:

    • Perform side-by-side comparisons under identical conditions

    • Create chimeric proteins to identify domain-specific differences

    • Express proteins in the same heterologous host

    • Conduct complementation studies in SecF-deficient strains

  • Biochemical validation:

    • Verify contradictory findings using multiple assays

    • Examine structure-function relationships through mutagenesis

    • Investigate species-specific interaction partners

  • Biological interpretation:

    • Consider if contradictions reflect genuine evolutionary adaptations

    • Determine if functional differences correlate with ecological niches

    • Analyze if metabolic specialization explains functional variations

How might the specialized metabolism of A. fermentans influence SecF structure and function?

The unique metabolic capabilities of A. fermentans, particularly its glutamate fermentation pathway and trans-aconitate utilization , could influence SecF in several ways:

  • Adaptation to sodium-dependent energetics:

    • A. fermentans uses a sodium motive force for membrane energetics

    • SecF may have evolved sodium-binding sites or sodium-dependent conformational changes

    • The energy coupling mechanism might differ from proton-dependent SecF proteins

  • Co-evolution with specialized secreted proteins:

    • Enzymes in the glutamate fermentation pathway may require specific secretion properties

    • SecF could be optimized for the export of specialized metabolic enzymes

    • Unique structural features may facilitate interaction with A. fermentans-specific substrates

  • Membrane environment adaptation:

    • A. fermentans has a specific membrane composition including disphosphatidylglycerol and phosphatidylethanolamine

    • SecF transmembrane domains may be optimized for this lipid environment

    • Protein-lipid interactions could influence SecF stability and dynamics

  • Anaerobic environment specialization:

    • As an anaerobe, A. fermentans SecF would function in consistently low-oxygen conditions

    • Potential reduction in disulfide bond formation or oxidation-sensitive residues

    • Possible adaptations for redox stability in the anaerobic gut environment

Research approaches to investigate these specialized adaptations include comparative sequence analysis, site-directed mutagenesis of potentially specialized regions, and functional assays under varying ionic conditions.

What approaches can be used to study the structure-function relationship of A. fermentans SecF?

Advanced approaches for structure-function studies include:

  • Structural determination methods:

    • X-ray crystallography using lipidic cubic phase techniques

    • Cryo-electron microscopy for membrane protein complexes

    • NMR spectroscopy for dynamic regions or domains

    • Hybrid methods combining low-resolution data with computational modeling

  • Mutagenesis strategies:

    • Alanine-scanning mutagenesis of conserved regions

    • Creation of chimeric proteins with well-characterized SecF homologs

    • Introduction of reporter groups at specific sites

    • Deletion analysis of non-conserved loops or domains

  • Biophysical characterization:

    • Site-directed spin labeling and EPR spectroscopy

    • Single-molecule FRET to observe conformational dynamics

    • Hydrogen-deuterium exchange mass spectrometry

    • Thermal stability analysis using differential scanning fluorimetry

  • Computational approaches:

    • Molecular dynamics simulations in membrane environments

    • Coevolutionary analysis to identify functionally coupled residues

    • Homology modeling based on existing SecF structures

    • In silico docking with substrate proteins and partner components

Each approach should consider the sodium-dependent energetics and specialized metabolism of A. fermentans when interpreting structure-function relationships.

How can A. fermentans SecF research inform our understanding of general protein translocation mechanisms?

Research on A. fermentans SecF can provide broader insights into protein translocation:

  • Adaptation to specialized energetics:

    • Understanding how translocation systems adapt to sodium versus proton gradients

    • Insights into the flexibility of energy coupling mechanisms

    • Evolution of ion-coupling sites in membrane transporters

  • Ecological adaptation of essential cellular machinery:

    • How core cellular processes adapt to specific environmental niches

    • Constraints and flexibility in the evolution of essential systems

    • Specialization versus conservation in fundamental cellular machinery

  • Metabolic context influence:

    • How specialized metabolic pathways shape protein secretion systems

    • Co-evolution of secretion machinery with the proteins they transport

    • Adaptation of translocation systems to specific cellular needs

  • Comparative mechanistic insights:

    • Identification of truly conserved versus adaptable features across diverse species

    • Understanding fundamental principles of membrane protein function

    • Discovery of novel regulatory mechanisms in protein translocation

These insights could lead to revised models of Sec-dependent protein translocation that incorporate greater flexibility and contextual adaptation than currently appreciated.

How might understanding A. fermentans SecF contribute to microbiome research?

A. fermentans SecF research has several potential applications in microbiome studies:

  • Functional ecology in the gut microbiome:

    • SecF as a marker for protein secretion capacity in related gut anaerobes

    • Understanding how protein secretion influences microbial community interactions

    • Correlation between SecF variants and ecological roles in the microbiome

  • Nitrogen metabolism in gut communities:

    • A. fermentans abundance correlates with nitrogen utilization efficiency in ruminants

    • SecF-dependent secretion may influence community-level amino acid metabolism

    • Protein secretion patterns could affect nitrogen cycling in the gut

  • Host-microbe interactions:

    • SecF-dependent secreted proteins may mediate interactions with the host

    • Understanding how gut bacteria adapt protein secretion to the host environment

    • Potential influence on gut health through secreted metabolic enzymes

  • Microbial adaptation in the gut:

    • SecF as a model for studying how essential cellular machinery adapts to the gut environment

    • Evolution of protein secretion systems in specialized gut residents

    • Comparative analysis of SecF across different gut microbes

What experimental challenges are specific to A. fermentans SecF research?

Table 6: Challenges and Solutions in A. fermentans SecF Research

ChallengeNature of DifficultyPotential Solutions
Limited genetic toolsFew genetic manipulation methods for A. fermentansHeterologous expression, develop transformation protocols
Membrane protein stabilityDenaturation during extraction and purificationScreen stabilizing detergents, nanodiscs, SMALPs
Native substrate identificationUnknown secreted proteins in A. fermentansSecretome analysis, bioinformatic signal sequence prediction
Functional reconstitutionRecreating native membrane environmentLiposomes with A. fermentans lipid composition
Sodium dependencyDifferent energetics from model systemsAssays incorporating sodium gradients rather than proton gradients
Anaerobic conditionsMaintaining oxygen-free environmentAnaerobic chambers, oxygen-scavenging systems

Strategic approaches to address these challenges:

  • Development of genetic tools specifically for A. fermentans or closely related species

  • Adaptation of established membrane protein techniques to account for A. fermentans-specific requirements

  • Collaborative approaches combining expertise in anaerobic microbiology, membrane protein biochemistry, and structural biology

  • Comparative studies with well-characterized SecF proteins to identify A. fermentans-specific features

  • Computational approaches to guide experimental design when direct experimentation is challenging

How can computational methods enhance A. fermentans SecF research?

Computational approaches can significantly advance SecF research:

  • Sequence-based analyses:

    • Multiple sequence alignment to identify conserved and variable regions

    • Coevolutionary analysis to predict functionally coupled residues

    • Signal sequence prediction to identify potential native substrates

    • Phylogenetic analysis to place A. fermentans SecF in evolutionary context

  • Structural modeling:

    • Homology modeling based on existing SecF structures

    • Molecular dynamics simulations in membrane environments

    • Molecular docking with partner proteins and substrates

    • Prediction of conformational states and transitions

  • Systems biology approaches:

    • Metabolic modeling incorporating SecF-dependent protein secretion

    • Network analysis of SecF interactions with other cellular components

    • Integration of transcriptomic and proteomic data to understand regulation

    • In silico comparison of SecF function across diverse species

  • Machine learning applications:

    • Prediction of functional effects of sequence variations

    • Classification of potential substrates based on signal sequences

    • Identification of patterns in SecF adaptation across different ecological niches

    • Optimization of expression and purification conditions

These computational methods can guide experimental design, generate testable hypotheses, and help interpret experimental data in the broader context of protein translocation mechanisms.

What emerging technologies could advance A. fermentans SecF research?

Several cutting-edge technologies show promise for SecF research:

  • Structural biology advances:

    • Cryo-electron microscopy for membrane protein complexes at near-atomic resolution

    • Micro-electron diffraction (microED) for small crystals

    • Integrative structural biology combining multiple data sources

    • Serial femtosecond crystallography using X-ray free electron lasers

  • Single-molecule techniques:

    • High-speed atomic force microscopy for observing SecF dynamics

    • Single-molecule FRET with improved fluorophores and detection

    • Nanopore-based translocation assays

    • Optical tweezers to measure forces during translocation

  • Membrane mimetic systems:

    • Advanced nanodiscs with controlled lipid composition

    • Cell-derived membrane vesicles maintaining native environment

    • Styrene-maleic acid lipid particles (SMALPs) for native extraction

    • Microfluidic systems for membrane protein studies

  • Genetic and genomic approaches:

    • CRISPR-Cas9 adaptation for A. fermentans genetic manipulation

    • Ribosome profiling to study SecF-dependent translation

    • High-throughput mutagenesis and functional screening

    • Metagenomic analysis of SecF diversity in microbiome samples

How might A. fermentans SecF research contribute to understanding bacterial evolution and adaptation?

SecF research can provide evolutionary insights through:

  • Protein secretion evolution in specialized metabolic contexts:

    • How essential cellular machinery adapts to unique metabolic niches

    • Evolution of SecF in the context of amino acid fermentation pathways

    • Adaptive changes in response to specific substrate requirements

  • Comparative genomics perspectives:

    • Correlation between SecF sequence and genome-wide adaptations

    • Analysis of selective pressures on different SecF domains

    • Identification of co-evolving genes in the protein secretion pathway

  • Ecological adaptation signatures:

    • SecF adaptations specific to the gut environment

    • Comparison between A. fermentans and other gut residents

    • Correlation between SecF variants and host species adaptation

  • Horizontal gene transfer analysis:

    • Evidence for horizontal transfer of sec genes

    • Integration of novel features into the conserved Sec system

    • Mosaic evolution of protein translocation machinery

These evolutionary insights could refine our understanding of how essential cellular systems evolve and adapt while maintaining core functionality.

What potential applications might emerge from detailed characterization of A. fermentans SecF?

Long-term applications could include:

  • Biotechnological applications:

    • Engineered secretion systems for difficult-to-express proteins

    • Development of sodium-coupled protein secretion systems

    • Optimization of protein production in anaerobic fermentation processes

    • Novel expression tags or fusion partners based on A. fermentans SecF domains

  • Therapeutic relevance:

    • Targets for selective inhibition of pathogenic anaerobes

    • Design of narrow-spectrum antimicrobials targeting specific SecF variants

    • Probiotic engineering for enhanced protein secretion in the gut

    • Modulation of microbiome protein secretion profiles

  • Synthetic biology applications:

    • Creation of synthetic cells with customized secretion capabilities

    • Engineering of minimal translocation systems with defined properties

    • Development of biosensors based on SecF conformational changes

    • Orthogonal protein secretion systems for synthetic biology applications

  • Fundamental science advances:

    • Refined models of membrane protein function and evolution

    • New paradigms for understanding protein translocation mechanisms

    • Insights into adaptation of essential cellular machinery

    • Principles of membrane protein engineering and design

These applications highlight the broad relevance of basic research on specialized bacterial systems like the A. fermentans SecF protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.