Recombinant Acidianus bottle-shaped virus Putative transmembrane protein ORF112 (ORF112)

Shipped with Ice Packs
In Stock

Description

Introduction to ORF112 Protein

ORF112 is a putative transmembrane protein encoded by the Acidianus bottle-shaped virus (ABV), an archaeal virus that infects hyperthermophilic archaea of the genus Acidianus. The protein derives its name from its genomic location (Open Reading Frame 112) and consists of 112 amino acids, making it a relatively small viral protein with specialized membrane-associated functions . As a transmembrane protein, ORF112 likely plays crucial roles in viral morphogenesis, host cell interaction, and potentially in the unique viral release mechanisms characteristic of archaeal viruses that infect extremophiles .

The recombinant form of this protein, produced primarily for research purposes, enables detailed structural and functional studies that would otherwise be challenging with naturally occurring viral proteins. This review focuses specifically on the recombinant version of ORF112, its production methods, structural characteristics, and potential applications in various research contexts.

Classification and Morphology

The Acidianus bottle-shaped virus (ABV) represents a unique viral entity that infects hyperthermophilic archaea belonging to the genus Acidianus. As its name suggests, ABV exhibits a distinctive bottle-shaped morphology unlike any other known virus, warranting its classification into the viral family Ampullaviridae .

ABV infects Acidianus hosts that typically thrive in extreme environments characterized by high temperatures (often exceeding 80°C) and acidic conditions (pH 2-3). This extremophilic lifestyle necessitates specialized viral proteins capable of maintaining structural integrity and function under these harsh conditions .

Genomic Organization and ORF112 Context

The ABV genome consists of linear double-stranded DNA approximately 23,814 base pairs in length with a G+C content of 35%. The genome features a 590-bp inverted terminal repeat and encodes 57 predicted open reading frames (ORFs), one of which is ORF112 .

Remarkably, genomic analyses have revealed that only three of the 57 predicted ORFs in ABV show significant sequence similarity to known proteins in public databases. These include genes encoding a glycosyltransferase, a thymidylate kinase, and a protein-primed DNA polymerase. This limited homology to characterized proteins underscores the unique nature of ABV and its encoded proteins, including ORF112 .

The genomic context of ORF112 within the ABV genome may provide insights into its potential function. While specific information about neighboring genes is limited in the available search results, the position of ORF112 within the viral genome could influence its expression timing during infection and potentially its interaction partners.

Expression Systems and Production Methods

Recombinant ORF112 protein is primarily produced in prokaryotic expression systems, most commonly Escherichia coli. The protein is typically expressed with an N-terminal histidine tag (His-tag) to facilitate purification using affinity chromatography methods . This expression system allows for relatively high yields of the recombinant protein while maintaining proper folding of the transmembrane domains.

The general production workflow involves:

  1. Cloning the ORF112 gene sequence into a suitable expression vector

  2. Transformation of competent E. coli cells

  3. Induction of protein expression under optimized conditions

  4. Cell lysis and protein extraction

  5. Purification using affinity chromatography and additional purification steps as needed

  6. Quality control to verify protein identity, purity, and activity

Membrane Integration and Viral Structure

As a transmembrane protein, ORF112 likely plays crucial roles in the viral life cycle related to membrane integration and viral structure. While the specific function of ORF112 in ABV is not explicitly detailed in the available research, insights can be drawn from studies on similar archaeal viral systems .

Some archaeal viruses utilize specialized membrane proteins to form virus-associated pyramids (VAPs), which are egress structures that facilitate viral release from host cells. These structures integrate into the host cell membrane and assemble into hollow, sevenfold symmetric pyramids that puncture the protective surface layer of the host cell, allowing newly replicated viral particles to escape .

While it has not been definitively established that ORF112 participates in such structures, its transmembrane nature makes it a candidate for involvement in membrane remodeling during viral egress. The protein could potentially:

  • Integrate into host cell membranes

  • Participate in the formation of specialized viral exit structures

  • Facilitate viral assembly at membrane interfaces

  • Contribute to viral stability in extreme environments

Potential Interaction with Host Systems

The transmembrane nature of ORF112 positions it at the interface between viral and host systems. This strategic location suggests potential roles in:

  1. Host recognition and viral entry

  2. Modulation of host membrane properties

  3. Recruitment of host factors for viral replication complexes

  4. Evasion of host defense mechanisms

Interestingly, some viral transmembrane proteins have the striking capability to spontaneously integrate and self-assemble into structures in biological membranes across domains of life—archaea, bacteria, and eukaryotes—rendering them universal membrane remodeling systems . Whether ORF112 possesses such capabilities remains an area for further investigation.

Research Applications and Future Perspectives

Recombinant ORF112 has several potential applications in research and biotechnology:

  1. Structural biology studies: As a relatively small transmembrane protein from an extremophilic virus, ORF112 represents an attractive target for structural determination using techniques such as X-ray crystallography, cryo-electron microscopy, or nuclear magnetic resonance spectroscopy.

  2. Membrane protein integration studies: The ability of some viral proteins to integrate into diverse membrane systems makes ORF112 a potential model for studying membrane protein integration mechanisms.

  3. Extremozyme applications: Proteins from extremophilic organisms often exhibit extraordinary stability under harsh conditions. If ORF112 shares these properties, it could potentially be engineered for biotechnological applications requiring stable membrane proteins.

  4. Evolutionary studies: The limited sequence homology between ABV proteins and those from other viruses makes them valuable for studying viral evolution and the potential for convergent evolution of viral mechanisms.

  5. Nanobiotechnology: Self-assembling viral proteins have been utilized in developing nanostructures for various applications. If ORF112 exhibits self-assembly properties, it could be valuable in this emerging field.

The research potential of ORF112 extends beyond these applications, particularly as more is learned about its structure and function in the viral life cycle.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All protein shipments are standardly packaged with blue ice packs. If dry ice packaging is required, please contact us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a final concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is finalized during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
ORF112; Putative transmembrane protein ORF112
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-112
Protein Length
full length protein
Species
Acidianus bottle-shaped virus (isolate Italy/Pozzuoli) (ABV)
Target Names
ORF112
Target Protein Sequence
MSCQIYPSQMCPGKAYKNCKLNIMNFWEVICIYYFALQGSFLGILVNLPILVTTLPLLPP ALFFYLMYLFALPLKDIFNIFFPSLDPILIPILIFFLVGVSRARLSKVFKWR
Uniprot No.

Target Background

Database Links

KEGG: vg:5129816

Subcellular Location
Host membrane; Multi-pass membrane protein.

Q&A

What is the Acidianus bottle-shaped virus and what makes it structurally unique?

The Acidianus bottle-shaped virus (ABV) represents a novel archaeal virus with unprecedented morphology in the viral world. ABV virions exhibit a unique asymmetric bottle-shaped structure lacking icosahedral or regular helical symmetry elements. The virion consists of two completely different structures at each end with an envelope encasing a funnel-shaped core. This core has three distinct structural units: the "stopper" (involved in receptor recognition and adsorption), a nucleoprotein cone containing double-stranded DNA and DNA-binding proteins, and an inner core. The broad end features a remarkable structure with approximately 20 thin filaments regularly distributed around and inserted into a disc or ring, though their function remains unclear .

Electron microscopy studies have revealed that only the "stopper" element is directly attached to the viral DNA, suggesting its critical role in host interaction. The complex, asymmetric architecture of ABV represents a fundamentally novel type of virus particle that has led to its classification as the first representative of a new genus .

How does ORF112 nomenclature differ between viral species?

An important distinction must be made regarding ORF112 nomenclature across different viral species. The designation "ORF112" is used for different proteins in different viral systems. In cyprinid herpesvirus 3 (CyHV-3), ORF112 is a well-characterized protein containing an N-terminal intrinsically disordered region (IDR) and a C-terminal Zα domain that binds to left-handed Z-DNA and Z-RNA .

The Acidianus bottle-shaped virus genome contains 59 identified ORFs, but the search results do not specifically identify an ORF112 designation in this virus. The ABV genome is a linear, double-stranded DNA of 23,794 bp with 580 bp inverted terminal repeats. Among its ORFs, only three show limited amino acid sequence similarity (<40% identity) with known proteins: a protein-primed DNA polymerase, a thymidylate kinase, and a glycosyltransferase .

When conducting research on viral ORF112 proteins, it is crucial to specify the viral species being studied and not assume functional equivalence based solely on ORF numbering.

What are the key structural and functional features of Zα domains in viral proteins?

Zα domains are specialized protein domains that bind to left-handed Z-DNA and Z-RNA structures. In viral contexts, these domains are found in proteins from several species including vaccinia virus E3, cyprinid herpesvirus 3 (CyHV-3) ORF112, and certain cellular proteins (ADAR1, ZBP1, and PKZ) .

The CyHV-3 ORF112 Zα domain contains critical residues (N255 and Y259) that are essential for interactions with Z-conformation nucleic acids. Site-directed mutagenesis of these residues (N255A, Y259A) renders CyHV-3 unable to grow in cell culture, demonstrating the domain's critical importance for viral replication .

Key functional capabilities of Zα domains include:

  • Z-binding activity: The capacity to recognize and bind to Z-form nucleic acids

  • Liquid-liquid phase separation (LLPS) induction: Some Zα domains can drive the formation of membrane-less organelles through LLPS

  • A-to-Z conversion: The ability to convert double-stranded RNA from A-form to Z-form conformation

Notably, the CyHV-3 ORF112 Zα domain appears more positively charged than other Zα domains, which may contribute to its ability to interact with nucleic acids and promote LLPS .

What genome editing techniques can be applied to study ORF112 function?

Several genome editing approaches have been successfully employed to study viral ORFs, which can be adapted for ORF112 research. Based on the methodologies described in the search results, researchers can consider the following approaches:

  • Anti-CRISPR-based genome editing: This technique uses anti-CRISPR genes (e.g., acrID1) as selection markers to knock out genes of interest. For example, with the Sulfolobus islandicus rod-shaped virus 2 (SIRV2), researchers created knockout mutations by replacing target genes with the acrID1 gene, which inhibits CRISPR-Cas subtype I-D immunity .

  • CRISPR-based genome editing: This approach harnesses endogenous CRISPR-Cas systems of host organisms to target and modify viral genes. The process typically involves:

    • Identifying a protospacer in the gene of interest

    • Constructing a spacer based on the selected protospacer

    • Creating a mini-CRISPR array

    • Designing donor DNA fragments containing the desired deletion or mutation

  • BAC recombineering: For herpesviruses like CyHV-3, bacterial artificial chromosome (BAC) technology has been effectively used. Researchers generated an ORF112 knockout by replacing the gene with a marker cassette (galK), then tested its ability to reconstitute infectious virus after transfection into permissive cells .

  • Complementation assays: To verify that phenotypes result from specific gene deletions rather than polar effects, researchers can insert expression cassettes elsewhere in the genome. For CyHV-3 ORF112, inserting an ORF112 expression cassette under control of a CMV IE promoter rescued viral growth in the ORF112 knockout background .

  • Site-directed mutagenesis: To study specific functional domains or residues, researchers can introduce point mutations. In CyHV-3 ORF112, mutations in key Zα domain residues (N255A, Y259A) were lethal for viral replication, supporting the domain's essential role .

How can the essential nature of viral genes like ORF112 be determined experimentally?

Determining whether a viral gene is essential requires systematic experimental approaches. Based on the provided search results, the following methodology can be applied:

  • Gene knockout construction: Create a recombinant virus with the target gene deleted or replaced with a selection marker. For CyHV-3, researchers replaced ORF112 with a galK expression cassette using BAC recombineering .

  • Transfection assays: Transfect the knockout construct into permissive cells and observe for viral growth. Absence of viral plaques or replication suggests an essential function. With CyHV-3 ORF112 KO plasmid, no viral plaques formed after transfection, while the wild-type control successfully produced plaques .

  • Reversion testing: To confirm that growth defects result specifically from the gene deletion (rather than from unintended mutations elsewhere in the genome), perform reversion experiments. Transfect the knockout construct together with a wild-type fragment containing the gene and flanking regions to facilitate homologous recombination. Recovery of infectious virus with the restored gene confirms the gene's essential role. CyHV-3 ORF112 KO plasmid regained infectivity when co-transfected with wild-type ORF112 DNA .

  • Domain complementation: Test whether specific domains of the protein are sufficient for function by creating constructs expressing only portions of the protein. For CyHV-3 ORF112, expression of only the Zα domain (without the N-terminal intrinsically disordered region) was sufficient for normal viral replication .

  • Mutational analysis: Introduce specific mutations in key functional residues to determine their importance. The lethal effect of N255A-Y259A mutations in the CyHV-3 ORF112 Zα domain confirmed the essential role of its Z-nucleic acid-binding activity .

  • Plaque assays: Quantify viral growth by plaque assays to detect subtle growth defects in viable mutants .

What methods can be used to study liquid-liquid phase separation properties of ORF112?

Liquid-liquid phase separation (LLPS) is an emerging area of interest in viral protein research, particularly for proteins with intrinsically disordered regions (IDRs) like ORF112. Based on the search results and current methodologies in the field, researchers can employ the following approaches to study LLPS properties:

  • Computational prediction: Analyze protein sequences for features associated with LLPS, such as:

    • Intrinsically disordered regions (IDRs)

    • Low-complexity domains (LCDs)

    • Charge distribution patterns

    • Q-rich and H-rich regions (both shown to drive LLPS)

  • Fluorescence microscopy: Express fluorescently tagged ORF112 or its domains in cells and observe for the formation of membrane-less condensates. The relocalization of ORF112 into stress granules, as observed in CyHV-3 studies, provides evidence of its participation in phase-separated structures .

  • Stress granule association assays: Induce cellular stress to promote stress granule formation and assess colocalization of ORF112 with stress granule markers. The CyHV-3 ORF112 study showed that both the N-terminal IDR and the C-terminal Zα domain contribute to stress granule relocalization .

  • In vitro phase separation assays: Purify recombinant ORF112 or its domains and test their ability to undergo LLPS under various conditions (protein concentration, salt concentration, temperature, presence of nucleic acids).

  • Domain contribution analysis: Create constructs expressing different domains of ORF112 and assess their individual contributions to LLPS. In CyHV-3 ORF112, both the N-terminal domain (containing IDRs with Q-rich and H-rich LCDs) and the positively charged C-terminal Zα domain appear capable of inducing LLPS .

  • Mutation impact studies: Introduce mutations in key residues or regions predicted to be important for LLPS and assess the effects on condensate formation. The CyHV-3 study found that mutations in the Z-binding residues reduced, but did not eliminate, the protein's ability to relocalize to stress granules .

What is the importance of the Zα domain for viral replication?

The Zα domain in viral proteins like CyHV-3 ORF112 plays a critical role in viral replication, as evidenced by several experimental findings:

  • Essential for viral viability: Deletion of ORF112 from CyHV-3 was lethal for the virus, preventing the production of infectious virions. This defect could be rescued by reintroducing the gene, confirming that the loss of viability was specifically due to the absence of ORF112 .

  • Zα domain sufficiency: Remarkably, expression of only the C-terminal Zα domain of ORF112 (without the N-terminal intrinsically disordered region) was sufficient for normal viral replication in cell culture and virulence in carp. This indicates that the Z-binding function of the domain is the critical component required for viral replication .

  • Critical residues: Site-directed mutagenesis of two key residues in the Zα domain (N255A, Y259A) that are essential for Z-nucleic acid binding rendered the virus non-viable. This further confirms that the Z-binding activity of the domain is specifically required for viral replication .

  • Domain exchangeability: When attempting to rescue an ORF112 deletion with various Zα domains from different sources, only those with three specific properties could restore viral replication:

    • Z-binding activity

    • Capacity to induce liquid-liquid phase separation (LLPS)

    • Ability to perform A-to-Z conversion of double-stranded RNA

These findings suggest that the Zα domain contributes to viral replication through specific interactions with Z-form nucleic acids and potentially by modulating RNA structure and phase separation properties within infected cells.

How do the intrinsically disordered regions (IDRs) contribute to ORF112 function?

Intrinsically disordered regions (IDRs) in viral proteins like CyHV-3 ORF112 serve important functional roles despite lacking stable secondary structures. Based on the research findings, the N-terminal IDR of ORF112 contributes to function in several ways:

  • Dispensable for basic replication: Unlike the essential Zα domain, the N-terminal IDR of CyHV-3 ORF112 is not strictly required for viral replication in cell culture. Viruses expressing only the Zα domain can replicate efficiently .

  • Liquid-liquid phase separation: The IDR contains at least two low-complexity domains (LCDs):

    • A Q-rich (glutamine-rich) region

    • An H-rich (histidine-rich) region
      Both Q-rich and H-rich LCDs have been shown to drive LLPS, contributing to the formation of membrane-less organelles like stress granules .

  • Stress granule localization: The N-terminal domain contributes to the relocalization of ORF112 into stress granules during cellular stress responses. While the Zα domain alone can partially localize to stress granules, the full relocalization depends on both domains working together .

  • Functional redundancy: The research suggests a degree of functional redundancy between the N-terminal IDR and the C-terminal Zα domain, particularly in their ability to induce LLPS. This redundancy might explain why the virus can replicate without the N-terminal domain .

The combination of these properties suggests that while not essential for basic viral replication, the IDR of ORF112 likely contributes to optimal viral function through modulating protein interactions, cellular localization, and participation in phase-separated compartments within the cell.

How do point mutations affect the functionality of the Zα domain in ORF112?

Point mutations in key residues of the Zα domain can dramatically affect its functionality and consequently viral replication. Based on the research on CyHV-3 ORF112, the following effects have been observed:

  • Critical Z-binding residues: Crystallographic studies identified two residues in CyHV-3 ORF112 (N255 and Y259) as critical for interactions with Z-conformation nucleic acids. These residues are highly conserved among Zα domains and directly interact with the Z-DNA backbone .

  • Lethal mutations: Site-directed mutagenesis of these residues (N255A, Y259A) rendered CyHV-3 unable to grow in cell culture. This lethal effect confirms that the Z-nucleic acid-binding activity of ORF112 is essential for viral replication .

  • Impaired but not eliminated stress granule localization: Interestingly, while mutations in these Z-binding residues prevented viral replication, they only partially impaired the protein's ability to relocalize to stress granules. This suggests that stress granule localization occurs through both Z-binding-dependent and Z-binding-independent mechanisms .

  • Domain function specificity: When testing various Zα domains for their ability to rescue an ORF112 deletion, only those retaining three specific properties could restore viral replication:

    • Z-binding activity

    • Liquid-liquid phase separation capacity

    • A-to-Z conversion ability

This indicates that point mutations affecting any of these properties would likely impair viral function.

These findings demonstrate that even single amino acid changes in critical positions can abolish the essential functions of the Zα domain, highlighting the precise structural requirements for its activity in viral replication.

How can genome editing techniques be optimized for archaeal viral systems?

Optimizing genome editing for archaeal viral systems requires careful consideration of several technical aspects based on successful approaches documented in the research:

  • Selection of appropriate host-virus systems: For archaeal viruses, established systems like Sulfolobus islandicus and its associated viruses (e.g., SIRV2) provide valuable models. The choice of thermophilic archaeal hosts requires adaptation of protocols for high-temperature growth conditions (75-78°C as used for Sulfolobus) .

  • Electroporation optimization: For introducing DNA into archaeal cells, electroporation protocols need specific optimization:

    • Room temperature manipulation of cells

    • Immediate transfer of cells post-electroporation into pre-warmed media

    • Addition of virus (MOI of 1) during recovery phase if working with viral transformations

    • Incubation at high temperatures (75°C) without shaking during recovery

    • Use of specialized solid media (2x SCV with Gelrite®) for plating

  • Anti-CRISPR-based selection: Leveraging anti-CRISPR genes (like acrID1 which inhibits CRISPR-Cas subtype I-D immunity) as selection markers offers an effective strategy for archaeal systems. This approach enables selection without requiring auxotrophic hosts or antibiotics, which are often limited for archaeal systems .

  • CRISPR-based editing considerations:

    • For type III CRISPR systems, protospacers must be designed to target the template strand as these systems function only when crRNA is complementary to a transcript

    • Protospacer length should be specifically designed (39 nt length was used successfully)

    • Specialized vectors (like pGE1) can be used to create mini-CRISPR arrays

  • Overlap extension PCR optimization: For creating donor DNA fragments containing deletion alleles, overlap extension PCR needs optimization for high GC-content archaeal DNA .

  • Screening protocols: PCR-based screening with primers flanking the target region, followed by both agarose gel electrophoresis and DNA sequencing verification, provides robust confirmation of editing outcomes .

  • Plaque assay adaptation: For archaeal viruses, standard plaque assays require modification:

    • Pre-mixing host cells with virus dilutions

    • Incubation at high temperatures (78°C)

    • Use of specialized solid media (0.4% Gelzan™ CM/Gelrite® overlaid on 1.4% Gelzan plates)

    • Maintaining humidity during incubation (plates in tightly closed plastic boxes)

What insights can comparative studies of Zα domains across different viruses provide?

Comparative studies of Zα domains across different viruses offer valuable insights into viral evolution, function, and potential therapeutic targets:

  • Functional diversity mapping: Research on various Zα domains has revealed unexpected functional diversity. CyHV-3 studies showed that only Zα domains expressing three specific properties could rescue viral replication:

    • Z-binding activity

    • Liquid-liquid phase separation (LLPS) induction capacity

    • A-to-Z conversion ability

  • Evolutionary relationships: Zα domains appear in both cellular proteins (ADAR1, ZBP1, PKZ) and viral proteins (vaccinia virus E3, CyHV-3 ORF112), suggesting potential horizontal gene transfer events or convergent evolution. Comparative genomic analyses can reveal whether viruses acquired these domains from hosts or vice versa .

  • Structural determinants of function: Despite sequence variations, Zα domains maintain specific structural features required for Z-DNA/Z-RNA binding. Comparative structural studies can identify the minimal structural elements required for function and how variations influence binding specificity .

  • Species-specific adaptations: The CyHV-3 ORF112 Zα domain is more positively charged than other Zα domains, suggesting adaptations to specific viral life cycles or host environments. Comparative studies can reveal how these domains have been optimized for different viral contexts .

  • Novel functions discovery: The observation that some Zα domains can induce LLPS was first reported in the CyHV-3 study, highlighting how comparative studies can uncover previously unknown functions of these domains. Further comparisons may reveal additional novel functions .

  • Mechanistic understanding: Experimental swapping of Zα domains between viruses can clarify which specific properties are universally required versus those that are virus-specific, enhancing our mechanistic understanding of how these domains contribute to viral replication .

How might ORF112 interact with host immune responses in different systems?

While the provided search results don't directly address ORF112 interactions with host immune responses, we can formulate research-based hypotheses about these interactions based on the known properties of Zα domains and viral proteins:

  • Z-form nucleic acid sensing: Host immune systems include pattern recognition receptors that detect unusual nucleic acid structures, including Z-DNA/Z-RNA. The Zα domain of ORF112 might compete with host Z-DNA-binding proteins (like ZBP1) for binding to Z-form nucleic acids, potentially interfering with immune recognition .

  • Stress granule modulation: The research indicates that ORF112 can relocalize to stress granules, which are known to play roles in antiviral immune responses. By interacting with these structures, ORF112 might:

    • Disrupt stress granule formation or function

    • Sequester host immune factors in these compartments

    • Modify RNA processing during infection

  • Phase separation and immune evasion: The ability of ORF112 to induce liquid-liquid phase separation might create specialized compartments within infected cells where viral replication can proceed sheltered from host immune surveillance. This could represent a novel immune evasion strategy .

  • RNA structure modulation: The A-to-Z conversion capability of the Zα domain suggests that ORF112 could alter the structure of host or viral RNAs, potentially:

    • Preventing recognition by host RNA sensors like RIG-I or MDA5

    • Interfering with host microRNA processing

    • Modulating translation of immune-related transcripts

  • System-specific adaptations: In archaeal systems like the Acidianus bottle-shaped virus, which infects extremophile hosts, the interactions would likely differ significantly from those in eukaryotic systems like cyprinid herpesvirus 3. Research comparing these systems could reveal fundamental principles of host-virus interactions across domains of life .

These potential interactions represent important avenues for future research, particularly using comparative approaches across different viral systems harboring Zα domain-containing proteins.

What are the main challenges in expressing and purifying recombinant ORF112 proteins?

Based on the properties of ORF112 proteins described in the search results, several technical challenges can be anticipated in their expression and purification:

  • Intrinsically disordered regions: The N-terminal portion of CyHV-3 ORF112 contains an intrinsically disordered region (IDR) . IDRs often present challenges for expression and purification:

    • Susceptibility to proteolytic degradation

    • Poor expression yields in bacterial systems

    • Potential toxicity to expression hosts

    • Aggregation during purification

  • Phase separation properties: Both the N-terminal IDR and C-terminal Zα domain of ORF112 can induce liquid-liquid phase separation (LLPS) . This property can cause:

    • Aggregation during expression and purification

    • Concentration-dependent behavior that complicates handling

    • Difficulty achieving homogeneous preparations

  • Nucleic acid binding: The Zα domain binds to Z-DNA and Z-RNA , which can result in:

    • Co-purification of contaminating nucleic acids

    • Heterogeneous protein-nucleic acid complexes

    • Reduced solubility

  • Expression temperature considerations: For the Acidianus bottle-shaped virus proteins, which come from thermophilic archaea , expression in mesophilic hosts may result in:

    • Improper folding at lower temperatures

    • Inclusion body formation

    • Requirement for refolding procedures

Potential solutions include:

  • Expression strategies:

    • Use of specialized expression systems like insect cells or cell-free systems for IDR-containing proteins

    • Co-expression with chaperones to improve folding

    • Expression of individual domains separately

    • For thermophilic proteins, expression in thermophilic hosts or at elevated temperatures

  • Purification approaches:

    • Inclusion of nucleases in lysis buffers to remove bound nucleic acids

    • Use of high-salt conditions to disrupt nucleic acid interactions

    • Addition of crowding agents or phase separation modulators to maintain solubility

    • Rapid purification protocols to minimize degradation of IDRs

  • Solubility enhancement:

    • Fusion to solubility-enhancing tags (MBP, SUMO, etc.)

    • Addition of specific buffers or additives that prevent phase separation

    • Use of truncated constructs that remove problematic regions

  • Quality control:

    • Dynamic light scattering to assess homogeneity

    • Circular dichroism to confirm proper folding

    • Nucleic acid contamination assessment

    • Activity assays to confirm functional integrity

How can viral infectivity assays be optimized for different experimental systems?

Optimizing viral infectivity assays requires tailoring approaches to specific virus-host systems. Based on the methodologies described in the search results, the following optimizations can be considered:

  • System-specific considerations:

    For archaeal viruses (like Acidianus bottle-shaped virus or SIRV2):

    • High-temperature incubation (75-78°C) for thermophilic hosts

    • Specialized media formulations (e.g., 2x SCV)

    • Solid media adaptations using Gelrite® or Gelzan™ instead of agar (which doesn't solidify properly at high temperatures)

    • Humidity control during incubation (tightly closed containers)

    For eukaryotic viruses (like CyHV-3):

    • Appropriate cell lines (e.g., CCB cells for CyHV-3)

    • Temperature optimization (around 25°C for fish viruses)

    • Serum concentration adjustments based on cell type and virus

  • Plaque assay optimizations:

    • Pre-incubation of host cells with virus to enhance infection

    • Optimal overlay medium composition (concentration of solidifying agent)

    • Incubation time adjustments based on viral replication cycle

    • Plaque visualization techniques (neutral red staining, immunostaining, etc.)

  • Viral reconstitution from recombinant DNA:

    • Transfection method optimization (electroporation, lipofection, etc.)

    • DNA amount optimization

    • Recovery time determination post-transfection

    • Co-transfection strategies for complementation studies

  • Quantification methods:

    • Plaque forming units (PFU) calculations from appropriate dilutions

    • qPCR-based quantification of viral genomes

    • Flow cytometry for fluorescently tagged viruses

    • TCID50 (tissue culture infectious dose) determinations

  • Controls and validation:

    • Wild-type virus controls for comparison

    • Host range testing to ensure specificity

    • Revertant virus generation to confirm phenotype-genotype relationships

    • Multiple biological replicates to ensure reproducibility

These optimizations should be systematically tested and validated for each specific virus-host system to develop reliable and reproducible infectivity assays that can accurately measure the effects of genetic modifications or experimental treatments.

What bioinformatic tools are most useful for analyzing viral ORFs like ORF112?

For comprehensive analysis of viral ORFs like ORF112, researchers should employ a combination of specialized bioinformatic tools that address different aspects of protein structure and function:

  • Sequence analysis and homology detection:

    • BLAST and PSI-BLAST for identifying distant homologs

    • HHpred for detecting remote homology through hidden Markov model comparisons

    • HMMER for profile-based searches, particularly useful for viral proteins with limited sequence conservation

    • Multiple sequence alignment tools (MUSCLE, MAFFT, T-Coffee) for comparing ORF112 across viral species

  • Structural prediction:

    • AlphaFold2 or RoseTTAFold for predicting tertiary structure

    • PSIPRED for secondary structure prediction

    • JPred for consensus secondary structure prediction

    • TMHMM or TOPCONS for transmembrane region prediction (relevant for putative transmembrane proteins)

  • Disorder and phase separation prediction:

    • PONDR, IUPred2A, or DisEMBL for identifying intrinsically disordered regions (IDRs)

    • PLAAC or PrionW for detecting prion-like domains associated with phase separation

    • catGRANULE for predicting granule-forming proteins

    • PSPredictor for phase separation propensity prediction

  • Functional domain identification:

    • InterProScan for comprehensive domain identification

    • SMART for identifying signaling domains

    • Pfam for protein family classification

    • CDD for conserved domain detection, including Zα domains

  • Nucleic acid binding prediction:

    • BindN or BindN+ for nucleic acid binding residue prediction

    • DNAproDB for DNA-protein interface analysis

    • RBPmap for RNA-binding prediction

    • Structure-based tools like HADDOCK for modeling protein-DNA/RNA interactions

  • Comparative genomics tools:

    • OrthoMCL or OrthoFinder for ortholog identification across viral species

    • Mauve or progressiveMauve for whole genome alignments

    • PAML for selection pressure analysis on viral genes

    • VGAS (Viral Genome Annotation System) for specialized viral genome analysis

  • Specialized tools for viral research:

    • VIGOR for viral genome annotation

    • ViPR (Virus Pathogen Database and Analysis Resource) for comparative viral genomics

    • pVOGs (prokaryotic Virus Orthologous Groups) database for archaeal and bacterial virus gene families

    • PHASTER for prophage identification

When specifically analyzing Zα domains like those in ORF112, specialized structure-function analysis tools that can predict Z-DNA/Z-RNA binding sites and model the A-to-Z conversion process would be particularly valuable for understanding the molecular mechanisms underlying their essential functions in viral replication.

What emerging technologies could advance our understanding of ORF112 function?

Several cutting-edge technologies hold promise for deepening our understanding of ORF112 function in viral biology:

  • Cryo-electron microscopy (cryo-EM): High-resolution structural determination of ORF112 alone and in complex with Z-DNA/Z-RNA could reveal the precise molecular interactions underlying its essential functions. Cryo-EM is particularly valuable for studying proteins that undergo phase separation, as it can capture them in near-native states .

  • Live-cell phase separation imaging: Advanced microscopy techniques such as lattice light-sheet microscopy combined with optogenetic tools could enable real-time visualization of ORF112-mediated phase separation during viral infection, providing insights into its dynamics and regulation .

  • CRISPR interference (CRISPRi) time-resolved studies: Instead of complete gene knockouts, CRISPRi could enable temporal control over ORF112 expression during different stages of viral infection, helping to pinpoint exactly when its function is required .

  • Single-molecule fluorescence resonance energy transfer (smFRET): This technique could monitor conformational changes in nucleic acids induced by ORF112 binding, directly visualizing the A-to-Z conversion process mediated by its Zα domain .

  • High-throughput mutagenesis coupled with deep sequencing: Systematic mutagenesis of ORF112 followed by selection for viral replication and deep sequencing could generate comprehensive maps of residues critical for function, beyond the key Z-binding residues already identified .

  • Proximity labeling proteomics: Techniques like BioID or APEX2 could identify proteins that interact with ORF112 during viral infection, helping to place it within cellular and viral protein interaction networks .

  • In-cell NMR spectroscopy: This emerging technique could provide atomic-level insights into the behavior of ORF112's intrinsically disordered regions in living cells, particularly how they contribute to phase separation .

  • Nanobody development: Developing nanobodies that specifically recognize and potentially inhibit ORF112 could serve as both research tools to probe function and potential therapeutic leads .

  • Microfluidic approaches: Droplet-based microfluidics could enable high-throughput analysis of ORF112 phase separation properties under varied conditions, potentially identifying cellular factors that modulate this behavior .

These technologies, particularly when combined in integrative approaches, could significantly advance our understanding of how ORF112 and its Zα domain contribute to viral replication and host interactions.

How might understanding ORF112 contribute to broader antiviral research strategies?

Understanding ORF112 and its Zα domain could inform multiple antiviral research strategies with potential applications beyond the specific viruses studied:

  • Essential viral process targeting: The essential nature of ORF112 for viral replication, particularly its Zα domain functionality, identifies it as a promising antiviral target. Compounds disrupting Z-DNA/Z-RNA binding could potentially inhibit multiple viruses that depend on Zα domain-containing proteins .

  • Phase separation modulation: The discovery that ORF112 can induce liquid-liquid phase separation suggests a novel viral strategy that might be targeted. Small molecules that disrupt phase separation could represent a new class of antivirals with potential broad-spectrum activity .

  • Z-form nucleic acid binding inhibitors: Structure-based drug design targeting the conserved features of Zα domains could yield inhibitors effective against multiple viral species that utilize Z-DNA/Z-RNA binding proteins, including poxviruses (vaccinia virus E3) and herpesviruses (CyHV-3 ORF112) .

  • Host-virus interaction disruption: Understanding how ORF112 interacts with host components, particularly in stress granules, could reveal opportunities to disrupt these interactions while minimizing toxicity to host cells .

  • Cross-domain antiviral strategies: Insights from archaeal viruses like the Acidianus bottle-shaped virus could reveal fundamental virus-host interaction principles conserved across domains of life, potentially identifying targets for broad-spectrum antivirals .

  • Novel nucleic acid-targeting approaches: The A-to-Z conversion activity of Zα domains suggests potential for developing nucleic acid-based therapeutics that resist conversion or selectively target Z-form structures .

  • Therapeutic Zα domain engineering: Engineered Zα domains could potentially be developed as therapeutics that compete with viral proteins for Z-DNA/Z-RNA binding, similar to decoy receptor approaches used for other viruses .

  • Extremophile-derived antivirals: Research on archaeal viruses from extreme environments, like the Acidianus bottle-shaped virus, could yield thermostable antiviral compounds or approaches with unique mechanisms of action that could be adapted for human therapeutic use .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.