Recombinant Acidianus bottle-shaped virus Putative transmembrane protein ORF116 (ORF116)

What is the Acidianus bottle-shaped virus and what makes it unique?

The Acidianus bottle-shaped virus (ABV) infects strains of the hyperthermophilic archaeal genus Acidianus and possesses a morphology distinct from all other known viruses. Its genome consists of linear double-stranded DNA, containing 23,814 bp with a G+C content of 35%, and exhibits a 590-bp inverted terminal repeat. Of the 57 predicted open reading frames (ORFs), only three produced significant matches in public sequence databases with genes encoding a glycosyltransferase, a thymidylate kinase, and a protein-primed DNA polymerase. The unique genomic and structural features of ABV support its classification in the viral family Ampullaviridae. Remarkably, despite being an archaeal virus, one region at the end of the ABV genome shares similarities in both gene content and organization with regions in bacteriophage varphi29 and human adenovirus, suggesting potential evolutionary connections across domains of life .

What is the structural characterization of the ABV ORF116 protein?

The ORF116 protein from ABV (UniProt accession: A4ZUB4) is a putative transmembrane protein consisting of 116 amino acids. Its amino acid sequence (MEYVEPLAPLYGGEYSTTGIVTLSVGIALLVLANAFAYALVKAFGIQSYYGRLLGGIVLLVLSMLLTLSTNSINKAFEAFTFAIGEIIIGGLDVINDKSGWSQPVVSPTVGCQGGA) suggests a membrane-spanning topology. Computational analysis predicts hydrophobic regions consistent with transmembrane domains, particularly in the central portion of the protein where stretches of hydrophobic residues (including alanine, valine, leucine, isoleucine) predominate. The protein contains charged and polar residues at predicted membrane interfaces, which is typical of transmembrane proteins that anchor within lipid bilayers .

What techniques are commonly used to isolate and purify archaeal viruses for functional studies?

The isolation and purification of archaeal viruses typically involves a multi-step process. Initially, environmental samples from extreme habitats (such as high-temperature acidic hot springs) are collected and processed to remove cellular material, usually through filtration with 0.6-μm polycarbonate filters. The resulting filtrate is then concentrated using molecular weight cut-off filters (e.g., 100,000-MWCO). For further purification, density gradient ultracentrifugation using CsCl gradients is employed, with centrifugation typically performed at high speeds (e.g., 238,000 × g).

The presence of viral particles in gradient fractions can be verified using quantitative PCR (qPCR) targeting specific viral sequences. Positive fractions are then pooled and may undergo additional purification through a second CsCl gradient centrifugation. Final concentration of viral particles is achieved using molecular weight cut-off filters. For visualization, purified virus particles are commonly stained with 1.5% uranyl acetate and examined using transmission electron microscopy to confirm morphology and purity .

How can researchers identify the cellular host of a novel archaeal virus like ABV?

Host identification for archaeal viruses requires a multi-faceted approach combining bioinformatic and experimental methods. A particularly effective strategy involves the analysis of CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats)/Cas systems from potential host species. These systems function as adaptive immune mechanisms in archaea, incorporating viral DNA fragments as spacers within CRISPR arrays. By analyzing these spacer sequences and comparing them to viral genomes, researchers can identify previous infection events and potential hosts.

This bioinformatic approach can be coupled with fluorescence in situ hybridization (FISH) techniques, specifically CARD-FISH (Catalyzed Reporter Deposition-FISH), using dual-labeled probes targeting both the virus and the putative host. For this method, virus-specific probes (typically 250 bp in length) are designed to have matching hybridization temperatures at specific formamide concentrations (e.g., 67.7-70°C at 35% formamide). These probes are generated by PCR amplification from purified viral DNA and labeled with markers such as digoxigenin (DIG). Simultaneously, 16S rRNA-targeted probes specific to potential host organisms are employed.

The dual-probe approach allows visualization of virus-host interactions directly in environmental samples, confirming host identity without the requirement for culturing. Once a putative host is identified, experimental confirmation can be performed through culture-based infection studies if the host organism can be isolated and cultivated under laboratory conditions .

What methodological approaches can be used to study the function of ORF116 in ABV replication?

Investigating the function of ORF116 in ABV replication requires a combination of genetic, biochemical, and structural approaches:

• Genetic modification techniques: Researchers can adapt CRISPR-based genome editing methods similar to those developed for other archaeal viruses. This approach involves:

  • Identifying protospacers within the ORF116 gene

  • Constructing a mini-CRISPR array with a spacer targeting ORF116

  • Generating donor DNA fragments with the desired deletion or modification

  • Using overlap extension PCR for creating recombinant constructs

  • Selection of successful gene knockouts using appropriate markers

• Protein expression and analysis: Recombinant expression of ORF116 can be achieved by:

  • PCR amplification of the gene from viral DNA

  • Introduction of a Shine-Dalgarno sequence and an N-terminal tag (e.g., 6×His) for purification

  • Expression in a suitable host system

  • Purification using affinity chromatography

  • Functional characterization through biochemical assays

• Localization studies: The transmembrane nature of ORF116 suggests membrane association, which can be investigated through:

  • Immunolocalization using antibodies against the recombinant protein

  • Fluorescent protein fusions to track localization during infection

  • Membrane fractionation followed by Western blotting

  • Lipid binding assays to determine membrane specificity

How can researchers analyze the evolutionary relationships between ABV ORF116 and similar proteins in other viruses?

To analyze evolutionary relationships of ABV ORF116 with proteins from other viruses, researchers should employ a comprehensive computational approach:

• Sequence similarity searches: Utilize sensitive sequence comparison tools like PSI-BLAST, HHpred, or HMMER to identify remote homologs across viral families. The search should be iterative and include both archaeal viruses and viruses from other domains.

• Multiple sequence alignment: Align identified homologs using tools like MUSCLE, MAFFT, or T-Coffee, with careful attention to the transmembrane regions which may require specialized alignment algorithms.

• Phylogenetic analysis: Construct phylogenetic trees using maximum likelihood (RAxML, IQ-TREE) or Bayesian inference (MrBayes) methods. The analysis should incorporate appropriate substitution models for transmembrane proteins and account for the fast evolutionary rates typical of viral proteins.

• Structural prediction and comparison: Even in the absence of experimental structures, predicted structural models using tools like AlphaFold2 or I-TASSER can reveal structural conservation not apparent from sequence analysis alone. Structural similarities can provide insights into functional conservation across evolutionarily diverse viruses.

• Analysis of syntenic relationships: Examine the genomic context of ORF116 homologs in different viruses. Conservation of gene order or co-occurrence patterns can suggest functional relationships and potential protein-protein interactions.

This approach is particularly relevant given that ABV shows unexpected similarities to bacteriophages and eukaryotic viruses. For example, the finding that the ABV genome contains regions similar to those in bacteriophage varphi29 and human adenovirus suggests potential horizontal gene transfer events or convergent evolution that may extend to other genes, including ORF116 .

What culture conditions are optimal for maintaining the host system for ABV infection studies?

For maintaining host systems for ABV infection studies, researchers should establish cultures that mimic the extreme conditions of the virus's natural environment. Based on archaeal host systems for similar viruses, the following culture conditions are recommended:

• Temperature: Maintain cultures at extremely high temperatures, typically 80°C, reflecting the hyperthermophilic nature of Acidianus species.

• pH: Adjust media to highly acidic conditions, around pH 2.0, using sulfuric acid or other appropriate acids.

• Growth medium: Use synthetic base salts medium supplemented with appropriate energy sources. For anaerobic growth, a medium containing colloidal elemental sulfur with an 80:20 H₂-CO₂ headspace is recommended.

• Culture vessels: Utilize pressure-resistant vessels capable of withstanding high temperatures, preferably with temperature-resistant seals to prevent evaporation during long incubation periods.

• Growth monitoring: Track culture growth using absorbance measurements at 600-650 nm, acknowledging that the presence of sulfur may interfere with optical density readings. Alternative methods include cell counting by microscopy or protein content determination.

• Virus propagation: For virus infection experiments, concentrate environmental samples containing the virus through filtration (0.6-μm polycarbonate filters) followed by concentration using 100,000-MWCO filter concentrators. For controlled experiments, maintain a consistent multiplicity of infection (MOI) across studies .

What expression systems are most effective for producing recombinant ORF116 protein for structural and functional studies?

The expression of archaeal viral transmembrane proteins presents significant challenges due to their extreme stability requirements and membrane integration. Based on current methodologies, the following expression systems are recommended for ORF116:

• Thermophilic archaeal expression systems:

  • Host: Sulfolobus or related thermophilic archaeal species

  • Vectors: Shuttle vectors containing selectable markers (e.g., pyrF)

  • Induction: Heat-inducible promoters

  • Advantages: Native-like membrane composition and post-translational modifications

• E. coli-based expression systems:

  • Strains: C41(DE3), C43(DE3), or Rosetta-gami for improved membrane protein expression

  • Vectors: pET series with N-terminal or C-terminal tags for purification

  • Fusion partners: Consider SUMO, MBP, or TrxA fusions to improve solubility

  • Expression conditions: Lower temperatures (18-25°C) and reduced inducer concentrations

• Cell-free expression systems:

  • Components: E. coli extracts supplemented with archaeal lipids

  • Advantages: Direct incorporation into liposomes or nanodiscs

  • Scalability: Easily optimized through small-scale trials

For purification, a combination of detergent extraction (using mild detergents like DDM or LMNG) followed by immobilized metal affinity chromatography and size-exclusion chromatography is recommended. The addition of appropriate lipids during purification can help maintain protein stability and native conformation .

What analytical techniques are most appropriate for studying protein-lipid interactions of transmembrane proteins like ORF116?

For studying protein-lipid interactions of the ORF116 transmembrane protein, researchers should employ multiple complementary analytical techniques:

• Liposome binding assays:

  • Preparation of liposomes with varying lipid compositions, including archaeal-specific lipids

  • Incubation with purified ORF116 protein

  • Separation of bound and unbound protein by flotation in sucrose gradients

  • Quantification by Western blotting or fluorescence

• Microscale thermophoresis (MST):

  • Labeling of ORF116 with fluorescent dyes

  • Titration with various lipid compositions

  • Analysis of thermophoretic movement to determine binding affinities

  • Advantages: Requires small sample amounts and can detect weak interactions

• Solid-state NMR spectroscopy:

  • Incorporation of isotopically labeled ORF116 into lipid bilayers

  • Determination of protein orientation and dynamics within membranes

  • Analysis of specific lipid-protein contacts through distance measurements

  • Particularly valuable for thermostable proteins from extremophiles

• Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

  • Exposure of protein-lipid complexes to deuterium oxide

  • Time-resolved analysis of deuterium incorporation

  • Identification of protected regions indicating lipid binding sites

  • Advantages: Can be performed with relatively small amounts of protein

• Molecular dynamics simulations:

  • Construction of atomic models of ORF116 in various lipid environments

  • Simulation of protein-lipid interactions over time

  • Analysis of stable interaction sites and conformational changes

  • Complementary to experimental approaches for mechanism elucidation

These techniques together provide a comprehensive understanding of how ORF116 interacts with membranes, which is crucial for unraveling its role in viral replication and host interaction .

How can researchers differentiate between functional and structural roles of ORF116 in viral infection?

Differentiating between functional and structural roles of ORF116 requires a systematic approach combining genetic, biochemical, and imaging techniques:

• Genetic modification studies:

  • Create targeted mutations in different regions of ORF116 using CRISPR-based genome editing

  • Analyze the effects on viral assembly versus replication kinetics

  • Compare point mutations (affecting specific functions) with deletion mutations (affecting structure)

• Time-course analysis:

  • Use synchronized infection to track ORF116 localization at different stages

  • Correlate protein localization with specific viral replication events

  • Employ dual-labeling to visualize ORF116 in relation to viral and host structures

• Protein-protein interaction studies:

  • Perform co-immunoprecipitation experiments to identify binding partners

  • Use cross-linking followed by mass spectrometry to capture transient interactions

  • Analyze whether interactions are structural (assembly-related) or enzymatic (replication-related)

• Domain function analysis:

  • Express individual domains separately to test for independent functions

  • Create chimeric proteins with domains from related viral proteins

  • Assess complementation ability of different domains in ORF116-knockout viruses

• Data interpretation framework:

Through this integrated approach, researchers can distinguish whether ORF116 primarily serves as a structural component of the viral particle or has specific enzymatic or regulatory functions during the infection cycle .

What bioinformatic approaches can resolve contradictory predictions about ORF116 function?

When faced with contradictory predictions about ORF116 function, researchers should employ a multi-layered bioinformatic strategy:

• Consensus-based approach:

  • Apply multiple prediction algorithms for each functional aspect (transmembrane regions, binding sites, etc.)

  • Implement weighted scoring systems based on algorithm performance with archaeal proteins

  • Focus on regions with high consensus across methods

• Comparative genomics integration:

  • Analyze ORF116 in the context of gene neighborhood conservation

  • Identify co-evolution patterns with other viral proteins

  • Compare with distant homologs from related viruses to identify conserved motifs

• Structural bioinformatics:

  • Generate 3D models using multiple methods (AlphaFold2, I-TASSER, Rosetta)

  • Perform structural alignment with proteins of known function

  • Identify potential binding pockets and catalytic sites

  • Validate predictions through molecular dynamics simulations

• Machine learning approaches:

  • Train specialized models using archaeal viral proteins as training data

  • Implement deep learning approaches that can integrate multiple data types

  • Apply feature importance analysis to identify key predictive elements

• Resolution workflow for contradictory predictions:
  a. Identify the source of contradiction (e.g., different algorithms, different training datasets)
  b. Evaluate each algorithm's performance specifically with archaeal proteins
  c. Consider the extremophile nature of the host in evaluating predictions
  d. Prioritize predictions that align with experimental observations
  e. Design targeted experiments to resolve specific contradictions

By systematically addressing contradictions through this hierarchical approach, researchers can develop more reliable functional hypotheses for experimental validation .

How does the genome organization of ABV compare with other archaeal viruses, and what does this suggest about ORF116 function?

The genome organization of Acidianus bottle-shaped virus (ABV) exhibits distinctive features compared to other archaeal viruses, providing context for understanding ORF116 function:

• Genomic architecture comparison:
  ABV possesses a linear double-stranded DNA genome of 23,814 bp with a G+C content of 35% and features a 590-bp inverted terminal repeat. This structure differs from many other crenarchaeal viruses, such as the Sulfolobus islandicus rod-shaped viruses (SIRVs) and Acidianus tailed spindle virus (ATSV). ATSV, for instance, has a larger circular dsDNA genome of 70.8 kb. The linear genome with terminal repeats is more reminiscent of certain bacteriophages and eukaryotic viruses than typical archaeal viruses, suggesting potential horizontal gene transfer events .

• Gene content analysis:
  Among ABV's 57 predicted ORFs, only three produced significant matches in public sequence databases, and only one gene is shared with other sequenced crenarchaeal viruses. This limited homology indicates that ABV represents a highly divergent viral lineage. In contrast, other archaeal viruses like SIRVs share more genes among their members, with defined core and accessory genomes. The uniqueness of most ABV genes, including ORF116, suggests specialized functions adapted to its distinctive morphology and host interaction .

• Functional module organization:
  The ABV genome organization reveals an interesting hybrid nature. One genomic region shows similarity in both gene content and organization to corresponding regions in bacteriophage φ29 and human adenovirus, containing genes for a putative protein-primed DNA polymerase and a small putative RNA with a predicted secondary structure similar to the prohead RNA of bacteriophage φ29. This suggests that despite its archaeal host, ABV may share DNA replication and packaging mechanisms with bacterial and eukaryotic viruses .

• Implications for ORF116 function:
  The location of ORF116 within this genomic context suggests it may function in viral assembly, potentially as a structural component involved in the unique bottle-shaped morphology. Its predicted transmembrane nature, combined with its presence in a virus with limited gene sharing with other archaeal viruses, indicates a specialized role potentially related to host membrane interaction during entry or exit. The absence of homologs in other viruses further suggests that ORF116 may represent an adaptation specific to ABV's unique life cycle in extreme environments .

What experimental approaches could determine if ORF116 is involved in host recognition similar to other archaeal viral attachment proteins?

To determine if ORF116 functions in host recognition similar to other archaeal viral attachment proteins, researchers should implement a multi-faceted experimental approach:

• Binding assays with host cells:

  • Purify recombinant ORF116 with appropriate tags

  • Label protein with fluorescent dyes or gold particles

  • Incubate with host cells under various conditions

  • Analyze binding patterns using microscopy or flow cytometry

  • Compare binding to susceptible and resistant Acidianus strains

• Competitive inhibition studies:

  • Pre-incubate host cells with purified ORF116

  • Challenge with complete virions

  • Quantify reduction in infection efficiency

  • Perform dose-response analysis to determine inhibition kinetics

• Domain mapping experiments:

  • Generate truncated versions of ORF116

  • Test binding capacity of individual domains

  • Identify critical residues through alanine scanning mutagenesis

  • Create chimeric proteins with attachment domains from other viruses

• Structural analysis of host-protein interactions:

  • Identify potential host receptors through pull-down assays

  • Perform co-crystallization or cryo-EM of ORF116-receptor complexes

  • Map interaction interfaces through hydrogen-deuterium exchange

  • Validate key interactions through site-directed mutagenesis

• Virus binding assays with CRISPR-engineered variants:

  • Create viral variants with mutations in ORF116 using CRISPR-based genome editing

  • Analyze attachment efficiency to host cells

  • Perform time-course analysis to distinguish between attachment and entry functions

  • Complement with trans-expressed wild-type or mutant ORF116

These approaches would provide comprehensive data on whether ORF116 functions in host recognition, similar to viral attachment proteins identified in other archaeal viruses such as the SIRV2 family, while accounting for the unique environmental conditions required for ABV-host interactions .

What emerging technologies could enhance our understanding of ORF116 structure and function in extreme environments?

Several cutting-edge technologies show promise for advancing our understanding of ORF116 structure and function in extreme environments:

• Cryo-electron microscopy under extremophile conditions:

  • Development of cryo-EM sample preparation methods that preserve proteins in extremophile conditions

  • Implementation of acidic and high-temperature compatible grids

  • Visualization of ORF116 in native viral particles under conditions mimicking their natural environment

  • Potential for capturing different conformational states relevant to function

• Single-molecule biophysics approaches:

  • Adaptation of optical tweezers and magnetic tweezers for high-temperature measurements

  • Single-molecule FRET studies with thermostable fluorophores

  • Analysis of protein dynamics and conformational changes under extreme pH and temperature

  • Direct measurement of membrane interaction forces and kinetics

• Advanced mass spectrometry techniques:

  • Cross-linking mass spectrometry (XL-MS) optimized for acidic conditions

  • Native mass spectrometry of intact membrane protein complexes

  • Ion mobility-mass spectrometry for structural characterization

  • Protein footprinting approaches to map surface accessibility in different environments

• In situ structural biology:

  • Cellular cryo-electron tomography of infected archaeal cells

  • Correlative light and electron microscopy to track ORF116 during infection

  • In-cell NMR adapted for archaeal hosts

  • Visualization of protein-membrane interactions in native environments

• Computational approaches designed for extremophile proteins:

  • Molecular dynamics simulations incorporating high-temperature parameters

  • Machine learning algorithms trained on extremophile protein structures

  • Quantum mechanics/molecular mechanics (QM/MM) calculations for understanding unusual chemical stability

  • Specialized force fields for accurately modeling proteins under extreme conditions

These emerging technologies, when adapted for the extreme conditions relevant to ABV and its host, could provide unprecedented insights into the structural adaptations and functional mechanisms of ORF116 that enable its activity in environments that would denature most proteins .

How might research on ORF116 contribute to our understanding of viral evolution across the three domains of life?

Research on ORF116 from Acidianus bottle-shaped virus offers unique opportunities to advance our understanding of viral evolution across the three domains of life:

• Investigation of domain-crossing evolutionary mechanisms:
  The ABV genome shows unexpected similarities to both bacteriophages and eukaryotic viruses, particularly in DNA replication and packaging mechanisms. Detailed analysis of ORF116 and its potential structural or functional homologs across domains could reveal mechanisms of horizontal gene transfer or convergent evolution. This research may uncover whether ABV represents an ancient viral lineage that predates the divergence of the three domains or demonstrates more recent genetic exchange across domain boundaries .

• Exploration of adaptation to extreme environments:
  The thermoacidophilic nature of ABV's host environment imposes unique selective pressures on viral proteins. Understanding how ORF116 maintains structural integrity and function under these conditions provides insights into protein evolution under extreme constraints. Comparative analysis with membrane proteins from mesophilic viruses could reveal adaptive mechanisms that may be shared across domains of life or unique to specific lineages .

• Analysis of virus-host co-evolution:
  The interaction between ORF116 and archaeal host membranes represents a specialized adaptation. Research into this interaction can illuminate co-evolutionary processes between viruses and hosts across domains, particularly regarding membrane manipulation strategies. This may reveal whether viruses use conserved mechanisms to interact with fundamentally different host membrane architectures or have evolved domain-specific strategies .

• Investigation of viral protein structure-function relationships:
  Detailed structural and functional characterization of ORF116 could provide insights into the minimal functional requirements for transmembrane viral proteins. This may reveal fundamental principles of viral protein evolution that transcend domain boundaries, particularly regarding the balance between structural constraints and functional innovation .

• Development of evolutionary models for viral transmembrane proteins:
  ORF116 research could contribute to refined evolutionary models specifically addressing the unique constraints on viral transmembrane proteins. These models could help reconstruct the evolutionary history of viruses across domains and potentially address fundamental questions about the origin of viruses and their relationship to cellular life .

By positioning ORF116 research within this broader evolutionary context, scientists can contribute to our fundamental understanding of viral evolution while simultaneously advancing knowledge about specific adaptations in extremophile viruses .