Recombinant Acidianus bottle-shaped virus Putative transmembrane protein ORF166 (ORF166)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement. We will accommodate your request whenever possible.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
ORF166; Putative transmembrane protein ORF166
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-166
Protein Length
full length protein
Species
Acidianus bottle-shaped virus (isolate Italy/Pozzuoli) (ABV)
Target Names
ORF166
Target Protein Sequence
MAEIGEFLKKYAGFCGLLPPSVDNSLLDFLANLPIILVFLITMPVRFFICIFAGLAKVNP ICVLINLLPPLAIAIPFVTAQTPPVCSTQCQYCQSGKGECLNYNPTIAKYFTQCEKQLSV LNKIFCLVGIIIADVLNPILAFINPLIYLAIHKVICLNTNPCICGL
Uniprot No.

Target Background

Database Links

KEGG: vg:5129810

Subcellular Location
Host membrane; Multi-pass membrane protein.

Q&A

What is the Acidianus bottle-shaped virus and how does it relate to ORF166?

The Acidianus bottle-shaped virus (ABV) is a unique archaeal virus belonging to the family Ampullaviridae. It has the following characteristics:

  • Infects strains of the hyperthermophilic archaeal genus Acidianus

  • Features a distinctive bottle-shaped morphology unlike any other known virus

  • Contains linear double-stranded DNA genome of 23,814 bp with a G+C content of 35%

  • Genome contains 57 predicted ORFs, including ORF166

  • Exhibits a 590-bp inverted terminal repeat in its genome

  • Non-lytic infection (does not cause cell lysis)

The virus was isolated from a hot, acidic spring in Pozzuoli, Italy, and represents an archaeal-specific virion morphotype . ORF166 is one of the 57 predicted open reading frames in the ABV genome, and based on its sequence characteristics, it is predicted to be a transmembrane protein, potentially involved in viral structure or host interaction .

How is recombinant ORF166 produced for research purposes?

The standard methodology for producing recombinant ORF166 involves the following steps:

  • Gene Synthesis and Cloning: The ORF166 gene sequence is codon-optimized for the expression host (typically E. coli) and synthesized or amplified from the viral genome. It is then cloned into an expression vector with an appropriate tag (commonly His-tag) .

  • Expression System: The protein is primarily expressed in E. coli, as indicated in commercial recombinant ORF166 preparations .

  • Purification Process:

    • Initial isolation via affinity chromatography using the His-tag

    • Further purification may include size exclusion chromatography or ion exchange methods

    • Purity is typically validated using SDS-PAGE (>90% purity standard)

  • Formulation and Storage:

    • Final preparation is often lyophilized or provided in Tris/PBS-based buffer with 50% glycerol at pH 8.0

    • For long-term storage, aliquoting and storage at -20°C or -80°C is recommended

    • Working aliquots can be stored at 4°C for up to one week

  • Reconstitution Protocol:

    • Brief centrifugation prior to opening to bring contents to the bottom

    • Reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Addition of 5-50% glycerol (final concentration) for long-term storage

What structural characteristics of ORF166 have been determined, and what methods are used for structural analysis?

While the complete three-dimensional structure of ORF166 has not been definitively determined based on the provided search results, several approaches can be applied for structural analysis:

Computational Structural Prediction:

  • Transmembrane domain prediction algorithms suggest ORF166 contains multiple membrane-spanning regions

  • Secondary structure prediction indicates a mix of alpha-helical and coiled regions typical of membrane proteins

Experimental Approaches:

  • Circular Dichroism (CD) Spectroscopy: Useful for determining secondary structure elements (alpha-helices, beta-sheets)

  • Nuclear Magnetic Resonance (NMR): For smaller domains of the protein

  • X-ray Crystallography: Challenging for transmembrane proteins but possible with appropriate detergents

  • Cryo-Electron Microscopy: Particularly valuable if ORF166 is studied in the context of the whole virion structure

Researchers investigating ABV virion structure have employed techniques like transmission electron microscopy with negative staining, which could indirectly provide information about ORF166's arrangement in the viral particle .

The putative transmembrane nature of ORF166 suggests it may play a structural role in the viral envelope or participate in host-virus interactions during infection .

What is the hypothesized function of ORF166 in ABV biology, and what experimental approaches can be used to test these hypotheses?

Based on sequence analysis and viral genomic context, several hypotheses regarding ORF166 function can be proposed:

Potential Functions:

  • Structural Component: May contribute to the unique bottle-shaped morphology of ABV virions

  • Host Interaction: Might participate in host receptor binding or membrane fusion

  • Virion Assembly: Could play a role in viral particle formation

  • Transmembrane Transport: May facilitate movement of viral components across membranes

Experimental Approaches to Test These Hypotheses:

  • Gene Knockout/Mutation Studies:

    • CRISPR-based genome editing of the viral genome (if possible)

    • Site-directed mutagenesis to alter specific domains

    • Analysis of resulting phenotypic changes in virus morphology or infectivity

  • Protein-Protein Interaction Studies:

    • Co-immunoprecipitation with viral or host proteins

    • Yeast two-hybrid or mammalian two-hybrid screening

    • Proximity labeling approaches (BioID, APEX)

    • Pull-down assays using recombinant ORF166 as bait

  • Localization Studies:

    • Immunogold electron microscopy using antibodies against ORF166

    • Fluorescence microscopy using tagged versions in permissive systems

  • Functional Assays:

    • Lipid binding and membrane perturbation assays

    • Electrophysiology studies if channel/pore formation is suspected

    • Host range determination with ORF166 variants

  • Structural Biology Approaches:

    • Cryo-EM of the intact virion to position ORF166

    • NMR studies of specific domains

    • Crystallization trials of the full protein or domains

The hyperthermophilic nature of the host (Acidianus) presents additional challenges for functional studies, necessitating adaptations of standard protocols to extreme conditions (high temperature, low pH) .

How does ORF166 compare to other viral transmembrane proteins, particularly those from other archaeal viruses?

Comparative analysis of ORF166 with other viral transmembrane proteins reveals important insights:

Comparison with Other Archaeal Viral Proteins:

  • Sequence Homology:

    • Limited sequence homology to proteins from other archaeal viruses

    • ABV's genome shares only one homologous gene with other sequenced crenarchaeal viruses

    • This uniqueness aligns with ABV's classification in the distinct Ampullaviridae family

  • Structural Comparison:

    • Unlike the major coat proteins of Acidianus filamentous virus 1 (AFV1) that form a four-helix bundle

    • Different from the coat proteins of Sulfolobus islandicus rod-shaped virus (SIRV)

  • Functional Comparison:

    • May share functional analogies with transmembrane proteins from other archaeal viruses despite low sequence identity

    • Likely involved in host specificity determination, similar to other viral membrane proteins

Methodological Approaches for Comparative Studies:

  • Bioinformatic Analysis:

    • BLAST and PSI-BLAST searches against viral protein databases

    • Hidden Markov Model (HMM) profiling for distant relationships

    • Structural prediction comparison using AlphaFold or similar tools

  • Experimental Comparison:

    • Heterologous expression studies comparing behavior in various systems

    • Cross-complementation experiments to test functional conservation

    • Chimeric protein construction to identify critical domains

  • Evolutionary Analysis:

    • Phylogenetic studies to place ORF166 in context of viral protein evolution

    • Synteny analysis examining gene neighborhood conservation

    • Identification of conserved motifs that might indicate shared function

Unlike the better-characterized viral proteins like SARS-CoV-2 ORF6 (which antagonizes interferon signaling by disrupting STAT nuclear translocation), the function of ABV ORF166 remains largely speculative due to limited experimental characterization .

What roles might ORF166 play in the extreme thermophilic and acidophilic environment of its host?

The Acidianus host thrives in extreme conditions (temperatures around 80°C and pH 2), which presents unique challenges and opportunities for viral proteins:

Potential Adaptations and Functions in Extreme Environments:

  • Thermostability Mechanisms:

    • High proportion of hydrophobic residues in transmembrane regions to maintain stability

    • Potential disulfide bonds (note the presence of cysteine residues in the sequence)

    • Compact structural arrangements resistant to thermal denaturation

  • Acid Resistance Properties:

    • Reduced number of acid-labile bonds

    • Strategic positioning of charged residues to maintain function at low pH

    • Modified interaction surfaces for host binding under acidic conditions

  • Host Interaction Under Extreme Conditions:

    • Specialized binding interfaces compatible with modified host cell surfaces

    • Membrane fusion mechanisms adapted to rigid archaeal lipid membranes

    • Potential involvement in maintaining viral integrity in extreme environments

Experimental Approaches for Environmental Adaptation Studies:

  • Stability Assays:

    • Thermal shift assays to determine melting temperature

    • Circular dichroism at varying temperatures and pH values

    • Activity measurements under different temperature and pH conditions

  • Structural Analysis Under Extreme Conditions:

    • FTIR spectroscopy at high temperatures

    • NMR studies at varying pH values

    • Cryo-EM of virus particles after exposure to different conditions

  • Comparative Studies:

    • Comparison with mesophilic viral proteins of similar function

    • Engineering experiments introducing ORF166 into mesophilic systems

    • Directed evolution studies to identify critical residues for extremophile adaptation

Understanding ORF166's adaptations could provide insights into protein engineering for extreme conditions and viral adaptation to specialized niches .

What expression systems and purification strategies are optimal for functional studies of ORF166?

Optimizing expression and purification of ORF166 requires careful consideration of its properties as a transmembrane protein:

Expression Systems Comparison:

Expression SystemAdvantagesDisadvantagesSpecial Considerations for ORF166
E. coli- Well-established protocols
- High yield
- Cost-effective
- Potential misfolding of membrane proteins
- Inclusion body formation
- Codon optimization for E. coli
- Use of specialized E. coli strains (C41/C43)
- Fusion to solubility-enhancing tags
Yeast (P. pastoris)- Eukaryotic folding machinery
- Glycosylation capability
- Membrane protein expression
- Longer expression time
- Lower yields than E. coli
- Testing various promoters (AOX1, GAP)
- Optimization of induction conditions
Insect cells- Superior for complex membrane proteins
- Post-translational modifications
- Higher cost
- Technical complexity
- Baculovirus optimization
- Expression timing optimization
Cell-free systems- Rapid expression
- Direct incorporation of detergents/lipids
- Lower yields
- Higher cost
- Addition of nanodiscs or liposomes
- Optimization of redox conditions

Purification Strategy Optimization:

  • Initial Extraction:

    • Evaluate different detergents (DDM, LDAO, Triton X-100)

    • Test membrane solubilization conditions (time, temperature, detergent concentration)

    • Consider amphipol or nanodisc technologies for stabilization

  • Affinity Purification:

    • Compare different tags: His-tag, FLAG, Strep-tag II

    • Optimize imidazole concentration for His-tagged protein elution

    • Evaluate on-column detergent exchange options

  • Secondary Purification:

    • Size exclusion chromatography in appropriate detergent

    • Ion exchange chromatography if charge properties are favorable

    • Assess protein quality by dynamic light scattering

  • Functional Reconstitution:

    • Liposome reconstitution using archaeal-like lipids

    • Nanodisc incorporation for single-particle studies

    • Detergent removal strategies (biobeads, dialysis)

  • Quality Control:

    • Circular dichroism to confirm secondary structure

    • Thermal stability assays to verify proper folding

    • Mass spectrometry to confirm intact protein

Based on commercial preparations, a successful approach includes expression in E. coli with an N-terminal His-tag, though yield and functional activity may be improved with more specialized systems .

What imaging techniques are most appropriate for studying ORF166 in the context of ABV virion structure?

Understanding ORF166's role in ABV requires visualization at multiple scales:

Method-Specific Considerations:

Previous studies on ABV employed specific imaging protocols:

  • Virus particles were concentrated by precipitation with polyethylene glycol 6000 in 1M NaCl

  • Purification via CsCl buoyant density gradient (0.45 g/ml) ultracentrifugation at 48,000 rpm for 40 hours

  • Gradient fractions collected and dialyzed against 20 mM Tris-acetate, pH 6

For structural analysis, researchers have applied multivariate statistical analysis to electron microscopy images, with 2D average maps providing insights into virus structure . Similar approaches would be valuable for determining ORF166's position and arrangement within the virion.

How can researchers investigate potential interactions between ORF166 and host cell components?

Investigating ORF166-host interactions requires specialized approaches for archaeal systems:

Recommended Methodological Approaches:

  • Protein-Protein Interaction Studies:

    • Pull-down Assays: Using recombinant ORF166 as bait to identify host binding partners

    • Crosslinking-Mass Spectrometry: To capture transient interactions under physiological conditions

    • Yeast Two-Hybrid: For binary interaction screening (with adaptation for archaeal proteins)

    • Proximity Labeling: BioID or APEX2 fusion to ORF166 to identify proximal proteins in vivo

  • Membrane Interaction Studies:

    • Liposome Binding Assays: Using archaeal lipid compositions

    • Surface Plasmon Resonance: To measure binding kinetics to host membrane components

    • Fluorescence-based Membrane Perturbation Assays: To assess functional effects on membranes

  • Host Response Analysis:

    • Transcriptomics: RNA-seq of host cells expressing ORF166

    • Proteomics: Quantitative proteomics to identify changes in host protein abundance

    • Microscopy: Localization studies in host cells using fluorescently tagged ORF166

  • Functional Effect Assays:

    • Membrane Permeability Tests: To assess if ORF166 forms pores or alters membrane integrity

    • Ion Flux Measurements: To determine if ORF166 affects ion homeostasis

    • Cell Signaling Assays: To identify pathways affected by ORF166 expression

Experimental Design Considerations:

When designing interaction studies for ORF166, researchers should consider:

  • Hyperthermophilic Conditions: Experiments should ideally be conducted at elevated temperatures (75-85°C) to mimic native conditions

  • Acidic Environment: Interaction buffer systems should maintain pH ~2-3 to reflect the natural environment

  • Archaeal Membrane Composition: The unique lipid composition of archaeal membranes (isoprenoid sidechains, ether linkages rather than ester linkages) significantly differs from bacterial or eukaryotic systems and may affect protein-membrane interactions

  • Control Experiments: Including other viral membrane proteins or randomized peptides as controls for specificity

  • Validation Across Methods: Confirming interactions using multiple orthogonal techniques

What analytical techniques are most informative for characterizing the biochemical properties of purified ORF166?

Comprehensive characterization of ORF166 requires multiple complementary techniques:

Recommended Analytical Techniques:

  • Protein Chemistry Analysis:

    • SDS-PAGE: For purity assessment and apparent molecular weight determination

    • Native PAGE: To examine quaternary structure and oligomeric state

    • Isoelectric Focusing: To determine pI experimentally

    • Size-Exclusion Chromatography with Multi-Angle Light Scattering (SEC-MALS): For accurate molecular weight and oligomeric state determination in detergent

  • Structural Characterization:

    • Circular Dichroism (CD): To estimate secondary structure content and thermal stability

    • Fourier-Transform Infrared Spectroscopy (FTIR): Particularly valuable for transmembrane proteins

    • Differential Scanning Calorimetry (DSC): To measure thermostability

    • Limited Proteolysis: To identify stable domains and flexible regions

  • Interaction Studies:

    • Isothermal Titration Calorimetry (ITC): For quantitative binding thermodynamics

    • Microscale Thermophoresis (MST): For binding studies with minimal protein consumption

    • Surface Plasmon Resonance (SPR): For real-time interaction kinetics

    • Bio-Layer Interferometry (BLI): Alternative to SPR for interaction studies

  • Functional Assays:

    • Lipid Binding Assays: Using archaeal lipid compositions

    • Membrane Leakage Assays: To test potential pore formation

    • Thermal Stability Under Various Conditions: To assess stability at high temperatures

Sample Preparation Considerations:

As ORF166 is a transmembrane protein from a hyperthermophilic organism, special considerations include:

  • Buffer Composition:

    • Use buffers stable at high temperatures (PIPES, HEPES rather than Tris)

    • Include stabilizing agents like glycerol (50% typically used)

    • Consider archaeal-specific ions (test stability with different salt compositions)

  • Detergent Selection:

    • Screen multiple detergents (DDM, LDAO, Fos-choline, etc.)

    • Consider newer amphipathic polymers like amphipols or SMALPs

    • Test nanodiscs with archaeal lipid compositions

  • Temperature Considerations:

    • Perform stability assessments across a range of temperatures (25-95°C)

    • Determine optimal temperature for storage and functional studies

    • Consider temperature dependence of all analytical techniques

The characterization approach should reflect the natural environment of ORF166, with special attention to the extreme conditions of temperature and pH encountered in the native host .

What bioinformatic approaches can reveal insights about ORF166 structure and function?

Comprehensive bioinformatic analysis can provide valuable insights when experimental data is limited:

Recommended Computational Approaches:

  • Sequence Analysis:

    • Multiple Sequence Alignment: Identify conserved residues across homologs

    • Hidden Markov Models: Detect distant homologs not found by BLAST

    • Disorder Prediction: Identify flexible regions using PONDR, IUPred

    • Secondary Structure Prediction: Using PSIPRED, JPred

    • Transmembrane Domain Prediction: With TMHMM, Phobius, MEMSAT

  • Advanced Structural Prediction:

    • AlphaFold2/RoseTTAFold: Generate high-confidence structural models

    • Molecular Dynamics Simulations: Test stability of predicted structures in membrane environments

    • Coevolution Analysis: Identify potential interacting residues using methods like EVcouplings

  • Functional Prediction:

    • Gene Neighborhood Analysis: Examine genomic context across viral species

    • Protein Domain Recognition: Using Pfam, SMART, InterPro

    • Binding Site Prediction: Using CASTp, COACH, COFACTOR

    • Molecular Docking: Predict interactions with potential binding partners

  • Evolutionary Analysis:

    • Phylogenetic Analysis: Place ORF166 in evolutionary context

    • Selection Pressure Analysis: Identify residues under positive/negative selection

    • Ancestral Sequence Reconstruction: Infer evolutionary trajectory

Case Study with ABV ORF166:

Analysis of ORF166 reveals:

  • Strong hydrophobic character consistent with multiple transmembrane segments

  • No significant sequence matches in public databases, suggesting a unique evolutionary origin

  • Secondary structure predictions suggest a mix of α-helical transmembrane regions

  • Potential glycosylation sites in extra-membrane regions

  • Cysteine residues that may form disulfide bonds important for thermostability

How can researchers develop antibodies or other detection tools for ORF166 studies?

Developing detection tools for ORF166 requires strategies adapted to its unique properties:

Antibody Development Strategies:

  • Peptide Antibody Approach:

    • Epitope Selection: Choose hydrophilic, exposed regions predicted from structural models

    • Multiple Peptide Strategy: Generate antibodies against 2-3 different regions

    • Conjugation Chemistry: Use KLH or BSA carriers with optimized conjugation protocols

    • Validation: Confirm specificity against recombinant protein and viral lysates

  • Recombinant Protein Immunization:

    • Protein Format Options:

      • Full-length protein in detergent micelles

      • Soluble domain fragments

      • Fusion to carrier proteins to enhance immunogenicity

    • Animal Selection: Rabbits or mice, with consideration of multiple host species

    • Adjuvant Selection: Critical for optimal immune response (Freund's, Alum, etc.)

  • Monoclonal vs. Polyclonal Considerations:

    • Polyclonal Advantages: Higher sensitivity, multiple epitope recognition

    • Monoclonal Advantages: Consistency, specificity for single epitope

    • Recombinant Antibody Option: Phage display libraries for difficult antigens

Alternative Detection Approaches:

  • Aptamer Development:

    • SELEX (Systematic Evolution of Ligands by Exponential Enrichment) against purified ORF166

    • Advantages include stability at high temperatures relevant to hyperthermophilic viruses

  • Nanobody Development:

    • Single-domain antibody fragments with higher stability

    • Potential for better recognition of conformational epitopes

  • Engineered Binding Proteins:

    • Designed ankyrin repeat proteins (DARPins)

    • Affibodies or other scaffold proteins with thermal stability

  • Tagged Protein Approaches:

    • Engineering expression systems for tagged versions of ORF166

    • Split-GFP complementation for in vivo detection

Validation Strategy:

For any detection tool, comprehensive validation is essential:

  • Specificity Testing:

    • Western blot against recombinant protein and viral lysates

    • Immunoprecipitation followed by mass spectrometry

    • Preabsorption controls with immunizing antigen

  • Application-Specific Validation:

    • Immunofluorescence optimization and controls

    • Electron microscopy immunogold labeling protocol development

    • Flow cytometry validation if applicable

Given the putative transmembrane nature of ORF166 and extreme conditions of its native environment, special consideration should be given to detection tools that maintain recognition under varying conditions .

What emerging technologies might advance our understanding of ORF166 and other archaeal viral proteins?

Several cutting-edge technologies show particular promise for advancing archaeal virology:

Emerging Technologies with High Potential:

  • Structural Biology Advancements:

    • Cryo-Electron Tomography: For studying ORF166 in intact virions at near-atomic resolution

    • Microcrystal Electron Diffraction (MicroED): For membrane proteins resistant to traditional crystallization

    • Integrative Structural Biology: Combining multiple structural techniques with computational methods

    • 4D Structural Biology: Time-resolved structural studies to capture conformational changes

  • Single-Virus Technologies:

    • Single-Virus Tracking: Following infection dynamics in real-time

    • Correlative Light and Electron Microscopy (CLEM): Linking functional and structural information

    • Force Microscopy Techniques: Measuring mechanical properties of individual virions

  • Advanced Genomic/Proteomic Technologies:

    • Long-Read Sequencing: For complete viral genome assembly from environmental samples

    • Single-Cell Viral Transcriptomics: Measuring viral gene expression in individual infected cells

    • Spatial Transcriptomics/Proteomics: Mapping viral components within infected cells

    • Crosslinking Mass Spectrometry: For capturing protein-protein interactions in native contexts

  • Synthetic Biology Approaches:

    • Minimal Viral Systems: Reconstituting minimal functional units

    • Cell-Free Expression Systems: For high-throughput functional studies

    • CRISPR Technologies: For targeted viral genome editing and functional screening

    • Non-Model Organism Genetic Tools: Developing genetic systems for Acidianus

Application to ORF166 Research:

These technologies could specifically advance ORF166 research by:

  • Determining precise localization and orientation in the viral envelope

  • Identifying host interaction partners with higher sensitivity and in native conditions

  • Revealing dynamic structural changes during viral infection

  • Enabling genetic manipulation to assess function in viral replication

  • Providing insights into evolution through environmental sampling

The extreme growth conditions of Acidianus hosts (80°C, pH 2) present unique challenges but also opportunities for developing specialized techniques that might have broader applications in protein science .

How can comparative genomics and proteomics advance our understanding of ORF166 within the broader context of archaeal virus evolution?

Comparative approaches provide powerful insights into function and evolution:

Recommended Comparative Approaches:

  • Expanded Genomic Sampling:

    • Metagenomics of Extreme Environments: Identify new ABV-like viruses in diverse hot springs

    • Single-Virus Genomics: Sequence individual virions to capture population diversity

    • Long-Read Sequencing: Improve genome assembly of complex viral mixtures

    • Target Enrichment Approaches: Focus sequencing efforts on specific viral groups

  • Advanced Comparative Analysis:

    • Network-Based Genome Comparison: Move beyond pairwise comparisons

    • Protein Domain-Level Analysis: Identify shared functional modules despite sequence divergence

    • Synteny Analysis: Examine gene order conservation and genome architecture

    • Viral Protein Family Construction: Build comprehensive archaeal virus protein families

  • Evolutionary Analysis Methods:

    • Maximum Likelihood Phylogenetics: More accurate modeling of sequence evolution

    • Bayesian Approaches: Incorporate prior knowledge and uncertainty

    • Ancestral Sequence Reconstruction: Infer properties of ancestral viral proteins

    • Molecular Clock Analyses: Estimate divergence times when applicable

  • Protein Structure Comparison:

    • Structure-Based Alignments: Identify structural homologs despite low sequence identity

    • Fragment-Based Structural Analysis: Identify shared structural motifs

    • Comparison of Predicted Structures: Using AlphaFold2 models for comprehensive comparisons

Insights from Previous Comparative Studies:

Previous studies have revealed important patterns in archaeal virus evolution:

  • ABV genome contains only three genes with significant matches in public databases (encoding a glycosyltransferase, a thymidylate kinase, and a protein-primed DNA polymerase)

  • Only one homologous gene is shared between ABV and other sequenced crenarchaeal viruses

  • Surprisingly, one region of the ABV genome shows similarity in gene content and organization to bacteriophage varphi29 and human adenovirus

  • These patterns suggest a "primordial gene pool" as a source of viral genes rather than strict vertical inheritance

ORF166, as a protein without clear homologs, represents an opportunity to explore how unique viral functions evolve. Structural comparison may reveal distant relationships not detectable at the sequence level, similar to how the coat proteins of Acidianus filamentous virus 1 (AFV1) were found to share structural similarity with those of Sulfolobus islandicus rod-shaped virus despite low sequence identity .

What challenges exist in developing infection models to study ORF166 function in vivo?

Studying archaeal viruses presents unique challenges requiring specialized approaches:

Key Challenges and Potential Solutions:

  • Extreme Culture Conditions:

    • Challenge: Maintaining Acidianus cultures at 80°C and pH 2 requires specialized equipment

    • Solutions:

      • Develop specialized bioreactors with precise temperature/pH control

      • Establish simplified bench-scale systems for routine cultivation

      • Explore thermostable transparent materials for real-time imaging

  • Genetic Manipulation Limitations:

    • Challenge: Few genetic tools exist for hyperthermophilic archaea

    • Solutions:

      • Adapt CRISPR-Cas systems for high-temperature function

      • Develop thermostable selectable markers

      • Explore natural transformation mechanisms in Acidianus

  • Viral Stock Preparation:

    • Challenge: ABV does not form plaques, complicating virus quantification

    • Solutions:

      • Develop quantitative PCR protocols for viral genome quantification

      • Establish fluorescence-based detection methods

      • Standardize virus concentration protocols (already employing PEG precipitation and CsCl gradient purification)

  • Infection Synchronization:

    • Challenge: Achieving synchronized infection for temporal studies

    • Solutions:

      • Explore temperature-shift protocols to control infection initiation

      • Develop inducible host receptor systems if identified

      • Utilize high-MOI infection approaches

  • Visualization Limitations:

    • Challenge: Tracking infection in extremophilic conditions

    • Solutions:

      • Develop high-temperature compatible fluorescent proteins

      • Adapt correlative microscopy approaches for extreme conditions

      • Employ fixed-time-point sampling with advanced imaging

Experimental Design Framework:

Based on previous work with ABV and related viruses, a practical approach includes:

  • Host Cultivation:

    • Grow Acidianus strains in Brock's medium supplemented with 0.1% yeast extract and 0.2% sucrose at pH 3.0 and 80°C

    • Establish growth curves under various conditions to identify optimal infection windows

  • Virus Propagation:

    • Infect early-logarithmic phase cultures (similar to established protocols)

    • Monitor virus production by qPCR targeting the ORF166 gene

    • Harvest virus particles by low-speed centrifugation to remove cells, followed by PEG precipitation

  • Infection Studies:

    • Develop fluorescence in situ hybridization (FISH) protocols to track viral replication

    • Establish electron microscopy sample preparation protocols specific to infected Acidianus

    • Implement transcriptomic and proteomic approaches for temporal profiling

Despite these challenges, ABV's non-lytic replication strategy provides opportunities for establishing stable host-virus systems for long-term studies .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.