Recombinant Acidianus filamentous virus 1 Putative transmembrane protein ORF108 (ORF108)

Shipped with Ice Packs
In Stock

Description

Overview of Acidianus Filamentous Virus 1

Acidianus filamentous virus 1 (AFV1) belongs to the Lipothrixviridae family, specifically classified as a Gammalipothrixvirus. It infects hyperthermophilic, acidophilic crenarchaea of the genus Acidianus that inhabit extremely hot and acidic environments, particularly in locations such as Yellowstone National Park in the United States . The virion structure is characterized by its filamentous morphology, measuring approximately 9,100 Å in length and 210 Å in diameter, with a lipid-containing outer shell that encapsulates the viral genome .

AFV1 possesses a linear double-stranded DNA genome consisting of 20,869 base pairs that encodes 40 putative open reading frames (ORFs) . Interestingly, most of these encoded proteins show little sequence similarity to other known genes in sequence databases, making their functional characterization challenging but scientifically valuable . This genomic uniqueness highlights the evolutionary distinctiveness of hyperthermophilic archaeal viruses and their potential to reveal novel protein structures and functions.

Physicochemical Properties

The ORF108 protein exhibits several noteworthy physicochemical properties that contribute to its structural stability and function in extreme environments:

PropertyValueNote
Molecular Weight~13 kDaBased on amino acid composition
Theoretical pINot specified in dataLikely basic based on sequence analysis
HydropathicityHighContains multiple hydrophobic regions
StabilityThermostableAdapted to function at temperatures >85°C
StructurePutative transmembraneMultiple membrane-spanning domains predicted

These properties reflect evolutionary adaptations to the extreme environmental conditions in which AFV1 replicates, particularly the high temperatures and acidic conditions that would denature most conventional proteins .

Expression Systems

The recombinant ORF108 protein is typically produced using bacterial expression systems, with Escherichia coli being the predominant host organism . The expression constructs generally incorporate affinity tags, such as polyhistidine (His) tags, to facilitate subsequent purification steps . The protein-coding sequence is typically cloned into suitable expression vectors under the control of inducible promoters, allowing regulated protein production.

Purification Methods

Standard purification protocols for recombinant ORF108 include:

  1. Affinity chromatography using metal chelation (for His-tagged variants)

  2. Size exclusion chromatography

  3. Ion exchange chromatography

The purified protein typically achieves >90% purity as determined by SDS-PAGE analysis . Following purification, the protein is commonly supplied in two forms:

  1. Lyophilized powder - for extended storage stability

  2. Solution in appropriate buffer systems - for immediate experimental use

Putative Membrane Association

Based on sequence analysis and structural predictions, ORF108 is classified as a putative transmembrane protein . The high proportion of hydrophobic residues suggests a role in viral envelope structure, potentially functioning in:

  1. Viral envelope formation and integrity

  2. Host cell membrane interaction during infection

  3. Structural stabilization of the virion in extreme environments

While the exact membrane topology remains to be fully characterized, the presence of multiple hydrophobic regions indicates several potential membrane-spanning domains .

Evolutionary Context

The ORF108 protein represents an interesting case study in viral evolution, particularly in the context of extremophilic viruses. Analyses of related archaeal viruses have revealed that certain viral proteins, such as the coat proteins of AFV1, display structural similarity to proteins from other virus families despite low sequence identity .

For instance, the four-helix bundle fold identified in major coat proteins of AFV1 is also present in the coat protein of Sulfolobus islandicus rod-shaped virus (SIRV), a member of the Rudiviridae family . This structural conservation despite sequence divergence suggests:

  1. Ancient evolutionary relationships between different archaeal virus families

  2. Convergent evolution driven by the extreme environmental conditions

  3. The existence of a limited repertoire of stable protein folds suitable for extreme conditions

Similar evolutionary patterns might apply to ORF108, though detailed structural comparisons with related proteins from other hyperthermophilic viruses are still needed.

Research Applications

The recombinant ORF108 protein has several potential applications in research:

  1. Structural biology studies of extremophilic viral proteins

  2. Investigation of protein stability mechanisms under extreme conditions

  3. Development of thermostable proteins for biotechnological applications

  4. Comparative studies of viral evolution in archaea

  5. Immunological studies and antibody production

  6. Protein-protein interaction studies to elucidate viral assembly mechanisms

The unique properties of ORF108, particularly its stability under extreme conditions, may offer insights applicable to protein engineering and biotechnology.

AFV1 Major Coat Proteins

While ORF108 is distinct from the major coat proteins of AFV1, understanding these structural proteins provides context for the viral architecture. AFV1 possesses two major coat proteins (MCPs) of 132 and 140 amino acids that bind DNA and form filaments when incubated with linear dsDNA . These proteins exhibit a C-terminal domain with a four-helix-bundle fold, which is structurally similar to the coat protein of SIRV despite low sequence identity .

Conserved Proteins Across Archaeal Viruses

Studies of archaeal viruses have identified certain highly conserved proteins shared across multiple viral families. For example, the protein encoded by ORF109 of AFV3 is present in members of three viral families (Lipothrixviridae, Rudiviridae, and "Bicaudaviridae") as well as in the unclassified Sulfolobus Turreted Icosahedral Virus (STIV) .

While ORF108 does not appear to be among these highly conserved proteins, understanding the patterns of conservation and divergence across archaeal viruses provides valuable context for interpreting its function and evolution.

Functional Studies

Several experimental approaches could elucidate the function of ORF108:

  1. Interaction studies with host cell components

  2. Mutational analysis to identify essential regions

  3. Localization studies during viral infection

  4. Viral genome editing to assess the impact of ORF108 modifications

Evolutionary Analysis

Comparative genomics and phylogenetic analyses could reveal:

  1. The evolutionary history of ORF108 across archaeal viruses

  2. Potential horizontal gene transfer events

  3. Selection pressures shaping ORF108 sequence conservation

  4. Related proteins in other extremophilic viruses

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please contact your local distributors for specific delivery time information.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C, and aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us and we will prioritize developing the specified tag.
Synonyms
ORF108; Putative transmembrane protein ORF108
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-108
Protein Length
full length protein
Species
Acidianus filamentous virus 1 (isolate United States/Yellowstone) (AFV-1)
Target Names
ORF108
Target Protein Sequence
MEQRFTHEDRFIMGLFPLLAVILISSNSSIIDIAMTVIIFGWIIYETLITVHFCKNYIET VESIMLGFVGFLGVLCLDKFPFGIILLIIYVIEGIYINVKTLKYARSC
Uniprot No.

Target Background

Database Links

KEGG: vg:2769183

Subcellular Location
Host membrane; Multi-pass membrane protein.

Q&A

What is Acidianus filamentous virus 1 (AFV1) and what are its general characteristics?

Acidianus filamentous virus 1 (AFV1) is a member of the Lipothrixviridae family that infects the hyperthermophilic, acidophilic crenarchaeon Acidianus hospitalis, which thrives in acidic hot springs at temperatures above 85°C and pH below 3, such as those found in Yellowstone National Park . The virion is approximately 9,100-Å long and contains a 20.8-kb linear double-stranded DNA genome that encodes 40 putative open reading frames, most of which show little sequence similarity to known genes in sequence databases . AFV1 has a distinctive structure with a filamentous core covered by a lipidic outer shell, making it one of the more complex archaeal viruses . The virus belongs to a larger group of filamentous archaeal viruses that represent the most abundant morphotype in these extreme environments .

What is known about the genomic context of ORF108 within the AFV1 genome?

The AFV1 genome contains 40 putative open reading frames, with ORF108 being one of the smaller coding regions predicted to encode a transmembrane protein . The genomic organization of AFV1 shows that many of its ORFs, including ORF108, have little sequence similarity to other genes in public databases, which has made functional annotation challenging for researchers . Studies of the AFV1 genome have revealed that it contains various functional modules including those for DNA packaging, virion morphogenesis, and host interaction, with ORF108 likely participating in one of these processes due to its predicted transmembrane nature . Comparative genomic analyses with related viruses such as SIFV (Sulfolobus islandicus filamentous virus) and other members of the Lipothrixviridae family might provide contextual information about the potential function of ORF108, especially if syntenic relationships exist . Understanding the genomic neighborhood of ORF108 can provide important clues about its functional associations and evolutionary relationships with proteins from other archaeal viruses .

How can bioinformatic tools be used to predict the structure and function of ORF108?

Bioinformatic analysis of ORF108 should begin with transmembrane domain prediction using specialized algorithms such as TMHMM, Phobius, or TOPCONS, which can identify potential membrane-spanning regions based on hydrophobicity patterns and charge distribution . Secondary structure prediction tools including PSIPRED and JPred can complement these analyses by identifying potential alpha-helical and beta-sheet regions that might indicate structural motifs common to viral transmembrane proteins . For more advanced structural insights, researchers should employ fold recognition methods like HHpred or I-TASSER that can detect remote homology even when sequence similarity is low, which is particularly useful for AFV1 proteins that typically show limited sequence conservation . Functional prediction can be approached through analysis of conserved domains using databases like Pfam and InterPro, while methods such as ConSurf can help identify evolutionarily conserved residues that might be critical for protein function . Integration of these various bioinformatic approaches can provide testable hypotheses about ORF108's potential role in the viral life cycle, whether it functions in viral assembly, membrane fusion, host recognition, or another process .

What expression systems are optimal for recombinant production of AFV1 ORF108?

For recombinant production of AFV1 ORF108, researchers should consider both prokaryotic and eukaryotic expression systems, each offering distinct advantages depending on research objectives. Escherichia coli-based expression systems, particularly those using BL21(DE3) strains with specialized vectors like pET or pBAD, have been successfully employed for other AFV1 proteins as demonstrated in studies of ORF157 and the major coat proteins (MCPs) . For membrane proteins like ORF108, specialized E. coli strains such as C41(DE3) or C43(DE3) that are engineered to handle toxic membrane proteins might yield better results by preventing formation of inclusion bodies . For more native-like conditions, archaeal expression hosts such as Sulfolobus species (particularly S. solfataricus) can be considered, though these systems typically have lower yields but may preserve proper folding of hyperthermophilic proteins . Expression should be optimized by testing various induction conditions (temperature, inducer concentration, duration) and incorporating solubility-enhancing fusion tags like SUMO, MBP, or TrxA, which can later be removed by specific proteases . For structural studies requiring isotopic labeling, minimal media with 15N ammonium chloride and 13C glucose should be used with appropriate expression protocols that maintain high protein yield under these more challenging conditions .

What purification strategies are most effective for isolating recombinant ORF108?

Purification of recombinant ORF108 requires specialized approaches due to its transmembrane nature, with solubilization being a critical first step that typically involves screening various detergents such as DDM, LDAO, or OG to identify optimal conditions for extracting the protein from membranes without denaturation . Affinity chromatography using His-tagged constructs with Ni-NTA resin is often the initial purification step, but binding and elution conditions must be carefully optimized to maintain the protein in a solubilized state throughout the procedure . Size exclusion chromatography (SEC) is typically employed as a final purification step and can also provide valuable information about the oligomeric state of ORF108 in solution, which may be relevant to its biological function . For proteins from hyperthermophilic organisms like AFV1, heat treatment (70-80°C) prior to chromatographic steps can sometimes be used to remove heat-labile contaminants from mesophilic expression hosts, though this approach must be validated to ensure the target protein remains stable . Quality control of the purified protein should include SDS-PAGE, Western blotting, mass spectrometry, and circular dichroism to confirm identity, purity, and proper folding before proceeding to functional or structural studies .

How can the structural characteristics of ORF108 be determined experimentally?

Structural characterization of ORF108 should employ a multi-technique approach beginning with circular dichroism (CD) spectroscopy to assess secondary structure content and thermal stability, which is particularly relevant for proteins from hyperthermophilic viruses like AFV1 . For higher resolution structural data, X-ray crystallography represents a powerful approach, though membrane proteins like ORF108 present significant crystallization challenges that may require extensive screening of conditions and possibly the use of lipidic cubic phase (LCP) or bicelle crystallization methods . Nuclear magnetic resonance (NMR) spectroscopy offers an alternative approach for structural determination, particularly for smaller membrane proteins or soluble domains, and can provide valuable information about dynamics and interactions in solution . Cryo-electron microscopy (cryo-EM) has emerged as a revolutionary technique for membrane protein structure determination and could be particularly suitable for ORF108, especially if it forms part of a larger complex within the viral envelope or if it can be reconstituted into nanodiscs or liposomes . Complementary techniques such as hydrogen-deuterium exchange mass spectrometry (HDX-MS), small-angle X-ray scattering (SAXS), and atomic force microscopy (AFM) can provide additional structural insights when used as part of an integrated structural biology approach .

How does ORF108 potentially contribute to viral assembly or host-virus interactions?

As a putative transmembrane protein, ORF108 likely plays a critical role in the viral architecture, potentially functioning at the interface between the internal nucleocapsid and the lipidic outer shell that characterizes AFV1 virions . Studies of other AFV1 proteins have shown that the virus employs a complex virion organization where major coat proteins like AFV1-132 and AFV1-140 interact with the genomic DNA and the lipid envelope, suggesting that ORF108 might contribute to these structural arrangements or provide additional functions at the membrane interface . The protein could be involved in host recognition and attachment, similar to spike proteins in other viruses, mediating the initial contact between AFV1 and Acidianus hospitalis cells under the extreme conditions where they coexist . Alternatively, ORF108 might function during viral assembly, potentially facilitating the incorporation of the lipid envelope around the nucleocapsid core or participating in the terminal structures of the filamentous virion, which are known to be important for virus-host interactions in related archaeal viruses . Comparative analysis with other archaeal viruses from the Lipothrixviridae family, such as SIFV or other AFV species (AFV3, AFV6, AFV7, AFV8), could provide evolutionary insights into the conservation and specialization of membrane proteins like ORF108 in these ancient viral lineages .

What approaches can be used to study protein-protein interactions involving ORF108?

Investigation of protein-protein interactions involving ORF108 should begin with co-immunoprecipitation (co-IP) assays using antibodies against ORF108 or epitope-tagged versions of the protein, followed by mass spectrometry analysis to identify binding partners within the viral particle or host cell . Yeast two-hybrid (Y2H) screening, although traditionally challenging for membrane proteins, can be adapted using split-ubiquitin systems specifically designed for membrane protein interactions, potentially revealing partners among other viral proteins or host factors . For more direct biophysical characterization of specific interactions, techniques such as surface plasmon resonance (SPR), isothermal titration calorimetry (ITC), or microscale thermophoresis (MST) can provide quantitative binding parameters, though these approaches require highly purified proteins and may need detergent optimization to maintain ORF108 in a native-like environment . Crosslinking mass spectrometry (XL-MS) offers a powerful approach to capture transient or weak interactions directly in virions or membranes, providing spatial constraints that can inform structural models of ORF108-containing complexes . In situ approaches like proximity labeling using APEX2 or BioID fused to ORF108 could map the protein's interaction neighborhood within the complex environment of assembled virions or during infection, potentially revealing unexpected functional associations .

How can molecular dynamics simulations help understand ORF108 function in extreme environments?

Molecular dynamics (MD) simulations represent a powerful computational approach for studying ORF108's behavior in the extreme environments where AFV1 thrives, capable of modeling protein dynamics at the atomic level under conditions of high temperature (85°C) and low pH (pH < 3) that are challenging to replicate experimentally . These simulations can investigate how the transmembrane domains of ORF108 interact with lipid bilayers that mimic the viral envelope composition, providing insights into protein stability, orientation, and potential conformational changes that might occur during viral life cycles . Advanced simulation techniques like replica exchange molecular dynamics (REMD) or metadynamics can enhance sampling of the conformational space, helping to identify stable states and transition pathways that might be relevant to ORF108's function in viral assembly or host interaction . Integration of experimental data, such as cross-linking constraints or low-resolution structural information, into the simulation protocols through restrained MD approaches can significantly improve the accuracy and biological relevance of the computational models . The comparative analysis of ORF108 simulations under different conditions (varying temperature, pH, membrane composition) can provide valuable hypotheses about adaptation mechanisms that allow this protein to function in extreme environments, potentially informing biotechnological applications that require proteins with exceptional stability .

How can site-directed mutagenesis be used to investigate ORF108 function?

Site-directed mutagenesis represents a fundamental approach for investigating ORF108 function, beginning with the identification of conserved residues through sequence alignment with homologs from related archaeal viruses, followed by systematic mutation of these positions to assess their impact on protein function . Transmembrane regions predicted through bioinformatic analysis should be targeted for alanine-scanning mutagenesis, where consecutive residues are replaced with alanine to identify segments critical for membrane insertion, protein folding, or interaction with other viral components . Charged residues within or flanking transmembrane domains deserve special attention as they often play key roles in membrane protein topology, stability, and function, with mutations to oppositely charged amino acids potentially revealing electrostatic interactions essential for protein structure . The importance of specific residues for protein-protein interactions can be assessed by generating mutations and evaluating their effects on complex formation using techniques such as co-immunoprecipitation or pull-down assays, which was successfully applied in studies of other AFV1 proteins . Complementation assays, where mutant ORF108 variants are introduced into a viral genome lacking the wild-type gene, would provide the most direct evidence of functional significance, though such systems remain technically challenging for archaeal viruses and may require the development of specialized genetic tools .

What techniques can be used to assess the lipid interactions of ORF108?

Investigating lipid interactions of ORF108 requires specialized techniques beginning with liposome binding assays, where the protein is incubated with synthetic liposomes of defined composition followed by flotation gradient centrifugation to separate liposome-bound and free protein, thus revealing specific lipid preferences . Monolayer insertion assays can complement these studies by measuring changes in surface pressure when ORF108 is injected beneath lipid monolayers, providing quantitative data on the protein's ability to penetrate membranes of different compositions . More detailed molecular information can be obtained through hydrogen-deuterium exchange mass spectrometry (HDX-MS), which identifies regions of the protein that become protected from solvent upon lipid binding, thereby mapping the lipid-interacting surfaces with peptide-level resolution . Fluorescence techniques such as Förster resonance energy transfer (FRET) between labeled ORF108 and fluorescent lipids can monitor interactions in real-time and under various conditions, providing insights into the dynamics of these associations . Advanced biophysical methods including solid-state NMR spectroscopy and electron paramagnetic resonance (EPR) with site-directed spin labeling can determine the precise orientation and depth of insertion of ORF108 within lipid bilayers, critical information for understanding how this protein might function at the interface between the viral genome and lipid envelope .

How can functional assays be designed to test the role of ORF108 in viral infection?

Developing functional assays for ORF108 requires multifaceted approaches starting with generation of antibodies against the protein, which can be used in immunofluorescence microscopy to track its localization during different stages of viral infection in Acidianus hospitalis cultures . Virus binding assays using fluorescently labeled virions containing wild-type versus mutated or deleted ORF108 can determine if the protein participates in host cell attachment, which would be evident from quantifiable differences in binding efficiency . For investigating later stages of infection, quantitative PCR assays measuring viral genome replication in cells infected with wild-type versus ORF108-modified viruses could reveal roles in genome delivery or replication processes . More sophisticated approaches might include the development of AFV1 minigenomes or virus-like particles where ORF108 variants can be tested for their ability to package nucleic acids or form proper viral structures, similar to assays developed for other archaeal viruses . Given the extreme growth conditions required by the host, adaptations of traditional virological techniques will be necessary, potentially including the development of high-temperature infection protocols and specialized growth media that maintain stability of both host cells and viral particles throughout the assay period .

What are the latest findings regarding the evolutionary relationships of AFV1 proteins including ORF108?

Recent comparative genomic and structural studies have revealed unexpected evolutionary relationships between archaeal viruses, with analyses showing that the major coat proteins of AFV1 (AFV1-132 and AFV1-140) share a four-helix bundle fold with the coat protein of Sulfolobus islandicus rod-shaped virus (SIRV) despite minimal sequence similarity, suggesting that viral structural proteins can maintain structural conservation while diverging significantly at the sequence level . This discovery supports the classification of Lipothrixviridae and Rudiviridae into a single order, Ligamenvirales, and defines what researchers now recognize as a distinct lineage of dsDNA viruses infecting archaea . For transmembrane proteins like ORF108, evolutionary analysis is more challenging due to rapid sequence divergence, but structural approaches and analysis of physicochemical properties rather than primary sequence may reveal previously undetected relationships with proteins from other viruses or cellular organisms . The emerging concept that viral capsid or coat proteins represent part of the viral "self" genes that are vertically inherited suggests that detailed structural and functional characterization of ORF108 might contribute to better understanding the deep evolutionary history of archaeal viruses and their relationship to viruses infecting bacteria and eukaryotes . Future research directions should include systematic structural genomics efforts targeting archaeal viral proteomes, which could reveal whether the structural conservation observed for coat proteins extends to other functional classes including transmembrane proteins like ORF108 .

What cutting-edge technologies are emerging for studying proteins like ORF108 in extreme environments?

Advances in cryo-electron microscopy (cryo-EM) have revolutionized structural biology of challenging protein targets, with recent developments in sample preparation techniques making it increasingly feasible to visualize membrane proteins like ORF108 at near-atomic resolution within their native lipid environment or as part of larger viral assemblies . Integrative structural biology approaches that combine multiple experimental techniques (X-ray crystallography, NMR, cryo-EM, mass spectrometry) with computational modeling are becoming essential for complete characterization of viral components, allowing researchers to place individual proteins like ORF108 into their functional context within the virion architecture . Microfluidic systems capable of maintaining extreme temperature and pH conditions are emerging as valuable tools for observing virus-host interactions in real-time, potentially allowing visualization of ORF108 function during the actual infection process of Acidianus hospitalis . Advanced genetic tools including CRISPR-Cas systems adapted for extremophilic archaea promise to enable more sophisticated functional genetics studies, potentially allowing precise manipulation of ORF108 within the viral genome to assess its contribution to viral fitness . Developments in synthetic biology approaches for archaeal systems might soon permit the reconstruction of minimal viral systems, where the essentiality and sufficiency of proteins like ORF108 for specific viral functions could be directly tested through bottom-up assembly of viral components .

How might understanding ORF108 contribute to biotechnological applications?

Proteins from hyperthermophilic viruses like AFV1 represent valuable resources for biotechnology due to their exceptional stability under extreme conditions, with transmembrane proteins like ORF108 potentially serving as scaffolds for designing stable membrane proteins for various applications including biosensors, drug delivery systems, and biocatalysts that can function under harsh industrial conditions . Understanding the molecular basis of ORF108's thermal stability could inform protein engineering strategies for enhancing the thermostability of industrial enzymes or therapeutic proteins, potentially through identification of specific structural features or amino acid compositions that confer resistance to denaturation at high temperatures . The lipid-binding properties of ORF108 might be exploited for designing novel lipid nanoparticle formulations for drug or nucleic acid delivery, particularly for applications requiring stability in acidic environments such as gastric delivery systems or certain industrial processes . Structural motifs identified in ORF108 could inspire the design of synthetic transmembrane peptides capable of self-assembly into defined nanostructures for applications in synthetic biology and nanomaterials science . Beyond specific applications, the study of archaeal viral proteins like ORF108 continues to expand our understanding of the diversity of protein structure and function in nature, potentially revealing novel structural folds and biochemical mechanisms that could inspire entirely new approaches in protein design and synthetic biology .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.