Recombinant Acidianus filamentous virus 2 Putative transmembrane protein ORF159 (ORF159)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Acidianus filamentous virus 2 Putative transmembrane protein ORF159 (ORF159) is a protein derived from the Acidianus filamentous virus 2 (AFV-2), specifically from an isolate found in Italy/Pozzuoli . ORF159 is recognized as a putative transmembrane protein, implying it is likely integrated into a cell membrane . The protein is composed of 159 amino acids .

Function and Significance

ORF159 is annotated as a "putative transmembrane protein," suggesting it plays a role associated with cell membranes . Transmembrane proteins are involved in various biological processes, including cell signaling, transport, and maintaining cell structure .

Although the specific function of ORF159 is not yet fully understood, studies on similar viral proteins, such as those in coronaviruses, indicate potential roles in ion channel formation or host-virus interactions . For example, the Matrix (M) proteins in coronaviruses, which have distant homologs to ORF159, may form aqueous channels in the membrane . Proteins like ORF3a in SARS-CoV-2, which also shares some similarities with ORF159, are involved in ion channel activity and host immune response modulation .

Evolutionary Context

The broader family of viral proteins to which ORF159 belongs, known as the M/ORF3 superfamily, shows both conservation and diversification across different viruses . This superfamily includes the Matrix (M) proteins from coronaviruses, toroviruses, and arteriviruses, as well as ORF3-like proteins found in alpha- and beta-coronaviruses . The M proteins are highly conserved and are crucial structural components, whereas the ORF3-like proteins exhibit rapid diversification, suggesting their involvement in host-virus interactions .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is specifically requested. Advance notification is required for dry ice shipping, and additional charges will apply.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ORF159; Putative transmembrane protein ORF159
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-159
Protein Length
full length protein
Species
Acidianus filamentous virus 2 (isolate Italy/Pozzuoli) (AFV-2)
Target Names
ORF159
Target Protein Sequence
MTTPLCYSSPVNTPLSPSLLLLSLLLLLSTICGVLPLSLFCCGIGTGITLFNFDDTSDII AVDIASAICFIIFCNGFCCCCCSGDPPYASSTTSLAICDGMLSLLRGDPPPVAVTYAPIF IAFCMHNSMSLIESKSGLTAFLTRVTMTSSMLPFSSIIS
Uniprot No.

Target Background

Database Links

KEGG: vg:5656087

Subcellular Location
Host membrane; Multi-pass membrane protein.

Q&A

What is ORF159 and which organism does it originate from?

ORF159 is a putative transmembrane protein encoded by the Acidianus filamentous virus 2 (AFV2) genome. The name "ORF159" indicates it is an Open Reading Frame encoding a protein of approximately 159 amino acids. AFV2 belongs to the Lipothrixviridae family and infects Acidianus species, which are thermoacidophilic archaea that thrive in extreme environments characterized by high temperatures (>85°C) and acidic conditions (pH <3) . These archaea are commonly found in acidic hot springs, such as those in Yellowstone National Park, WY.

How does ORF159 compare to similar proteins in other archaeal viruses?

ORF159 belongs to a family of proteins that show sequence similarities to those encoded by genes located adjacent to rpoN in several bacteria . Particularly, ORF159 shares significant sequence homology with proteins involved in phosphotransferase systems, specifically the nitrogen-related enzyme IIA (PtsN) . The protein contains conserved amino acid residues, including a potentially phosphorylatable histidyl residue (positions 65-71), suggesting its activity might be regulated through phosphorylation mechanisms similar to those observed in bacterial systems . Related archaeal viruses like Acidianus filamentous virus 1 (AFV1) contain similar ORFs, such as ORF157, which has been characterized as having nuclease activity on linear double-stranded DNA .

What is the genomic context of ORF159 in AFV2?

ORF159 appears to be part of an operon structure that includes other genes like rpoN (encoding the alternative sigma factor σ54) and additional ORFs (such as ORF208) . The genomic organization suggests potential functional relationships between these genes, possibly related to transcriptional regulation or stress responses in the viral life cycle. Transcriptional analyses have indicated that ORF159 may be co-transcribed with ORF208, although there is evidence for an independent promoter that could specifically regulate these ORFs .

What is known about the structure of ORF159?

While detailed structural information specific to AFV2 ORF159 is limited in the available literature, inferences can be made based on related proteins. Similar transmembrane proteins from archaeal viruses typically contain hydrophobic regions that span the membrane, connected by charged regions that extend into the cytoplasm or extracellular space . Computational predictions and sequence analyses suggest ORF159 may share structural features with bacterial phosphotransferase system proteins, particularly those involved in nitrogen metabolism .

What are the predicted functional domains in ORF159?

Based on sequence homology, ORF159 contains domains similar to the bacterial nitrogen-related enzyme IIA (PtsN) components of the phosphotransferase system . The protein includes conserved amino acid residues at positions 65-71, including a potentially phosphorylatable histidyl residue, suggesting it may participate in phosphorelay signaling pathways . This conservation indicates functional importance and suggests that the activity of ORF159 might be regulated through phosphorylation mechanisms, similar to its bacterial homologs.

How does ORF159 differ from transmembrane proteins in other archaeal viruses?

While many archaeal viruses encode transmembrane proteins, ORF159 appears distinct in its sequence similarity to bacterial phosphotransferase system components . Unlike some other viral transmembrane proteins that primarily function in virus assembly or host cell attachment, ORF159's similarity to metabolic regulatory proteins suggests it might play a role in modulating host cell metabolism during infection. This distinguishes it from structural transmembrane proteins like those found in tailed spindle viruses, which are primarily involved in viral morphogenesis and host recognition .

What expression systems are recommended for recombinant ORF159 production?

For laboratory production of recombinant ORF159, E. coli expression systems have been successfully employed . The protein can be expressed with affinity tags, such as a histidine tag (His-tag), to facilitate purification . When designing expression constructs, researchers should consider the full-length protein (amino acids 1-159) to maintain structural integrity. Expression optimization may require adjusting temperature, induction conditions, and media composition to account for potential challenges in expressing archaeal viral proteins in bacterial systems.

What are the methods for studying ORF159 function in vitro?

Functional analysis of ORF159 can be approached through several methodologies:

  • Phosphorylation assays: Given the predicted phosphorylatable histidyl residue, in vitro phosphorylation assays using radioactive phosphate donors or phosphoprotein-specific detection methods can determine if ORF159 participates in phosphotransfer reactions.

  • Protein-protein interaction studies: Techniques such as pull-down assays, co-immunoprecipitation, and yeast two-hybrid screens can identify binding partners, providing insights into functional networks .

  • Site-directed mutagenesis: Creating alanine substitution mutations at conserved residues, particularly the putative phosphorylation site, can help determine essential amino acids for function, similar to approaches used for related viral proteins like AFV1-157 .

How can researchers generate and analyze ORF159 mutants?

Mutation analysis of ORF159 can be conducted using PCR-based site-directed mutagenesis or, for in vivo studies, through genomic integration approaches. Based on established protocols for similar viral ORFs:

  • Generate PCR fragments internal to ORF159 for cloning into appropriate vectors (such as pBGST18) .

  • Introduce the construct into the host cell through conjugation or other appropriate transformation methods.

  • Select for integration events using appropriate antibiotics.

  • Confirm disruption through Southern blot analyses or PCR verification .

  • Assess phenotypic changes by comparing growth rates, metabolic capabilities, or stress responses to wild-type strains .

For in vitro studies with recombinant protein, express both wild-type and mutant versions of ORF159 and compare their biochemical properties, such as phosphorylation status, protein interactions, or enzymatic activities.

What is the significance of ORF159 in understanding archaeal virus biology?

Studying ORF159 contributes significantly to our understanding of archaeal virus biology in several ways:

  • Virus-host interactions: ORF159's similarity to bacterial metabolic regulatory proteins suggests it may play a role in modulating host metabolism during infection, revealing potential mechanisms of viral control over archaeal hosts .

  • Evolutionary insights: The presence of bacterial-like phosphotransferase system components in archaeal viruses provides evidence for potential horizontal gene transfer events across domains, offering insights into the evolution of viruses and their hosts .

  • Adaptation to extreme environments: Understanding the structure and function of ORF159 can illuminate how archaeal viruses and their proteins are adapted to function in extreme conditions, such as high temperatures and acidic environments .

How does ORF159 research relate to studying virus-host interactions in extreme environments?

Research on ORF159 provides a unique window into virus-host interactions in extreme environments. Acidianus species thrive in conditions that would be lethal to most organisms, with temperatures exceeding 85°C and pH levels below 3 . Studying how viral proteins like ORF159 function in these conditions can reveal novel biochemical adaptations and protein stabilization mechanisms. The potential role of ORF159 in metabolic regulation, as suggested by its similarity to phosphotransferase system components, may indicate specialized strategies employed by archaeal viruses to manipulate host metabolism in extreme environments .

What biotechnological applications might arise from ORF159 research?

Research on ORF159 could lead to several biotechnological applications:

  • Thermostable enzymes: If ORF159 possesses enzymatic activity, its adaptation to extreme temperatures could make it valuable for industrial processes requiring thermostable proteins.

  • Protein engineering: Understanding the structural elements that confer stability to ORF159 in extreme conditions could inform the design of engineered proteins with enhanced stability for various applications.

  • Novel regulatory systems: If ORF159 functions in phosphorelay signaling, elements of this system could potentially be adapted for synthetic biology applications requiring regulated gene expression under extreme conditions.

What are the current limitations in ORF159 research?

Several challenges currently limit ORF159 research:

  • Structural data: There is a lack of high-resolution structural data specifically for AFV2 ORF159, limiting our understanding of its precise molecular functions and interactions.

  • Functional characterization: While sequence similarities suggest potential functions, direct experimental evidence of ORF159's role during viral infection remains limited.

  • Host system complexity: The extreme growth conditions required for Acidianus species make laboratory studies of native virus-host interactions technically challenging.

  • Limited genetic tools: Compared to bacterial systems, fewer genetic manipulation tools are available for archaeal viruses, complicating in vivo functional studies.

What advanced techniques could enhance ORF159 structural studies?

Several cutting-edge approaches could advance structural understanding of ORF159:

  • Cryo-electron microscopy: This technique could potentially resolve the structure of ORF159 in membrane-like environments, providing insights into its transmembrane organization.

  • X-ray crystallography: Following the approach used for AFV1-157 , crystallization and X-ray diffraction could reveal detailed structural information, particularly if the protein can be expressed and purified in sufficient quantities.

  • Integrative structural biology: Combining multiple techniques such as small-angle X-ray scattering, nuclear magnetic resonance, and computational modeling could overcome the challenges of working with membrane proteins.

  • In situ structural studies: Advanced techniques like electron tomography might allow visualization of ORF159 in the context of intact viruses or infected cells.

How might systems biology approaches enhance our understanding of ORF159 function?

Systems biology approaches could provide comprehensive insights into ORF159 function:

  • Interactome mapping: Comprehensive identification of protein-protein interactions involving ORF159 could place it within functional networks and suggest mechanisms of action .

  • Transcriptomics and proteomics: Analyzing changes in host gene expression and protein abundance in response to wild-type versus mutant ORF159 could reveal affected cellular pathways.

  • Metabolomics: Given ORF159's similarity to metabolic regulatory proteins, metabolomic analyses comparing wild-type and mutant infections could identify specific metabolic pathways influenced by this viral protein.

  • Computational modeling: Integration of experimental data into predictive models could generate testable hypotheses about ORF159's role in the viral life cycle and host metabolism.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.