Recombinant Acidianus filamentous virus 2 Putative transmembrane protein ORF202 (ORF202)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Acidianus Filamentous Virus 2 Putative Transmembrane Protein ORF202 (ORF202)

The recombinant ORF202 protein is derived from Acidianus filamentous virus 2 (AFV2), a hyperthermophilic archaeal virus classified within the Lipothrixviridae family. This protein is annotated as a putative transmembrane protein, suggesting potential involvement in viral-host membrane interactions or structural assembly. Its UniProt identifier is Q573C0, and it spans 202 amino acids (1–202 aa) .

Amino Acid Sequence and Motifs

The full-length ORF202 sequence includes hydrophobic regions indicative of transmembrane domains and conserved motifs that may mediate protein-protein interactions. Key features include:

FeatureDetail
Sequence Length202 aa (1–202 aa)
Hydrophobic RegionsPredicted transmembrane helices (e.g., residues 1–20: MNTHYLTINLLRAIAFGLAYSILEVNVPLFHYIPVVDYRVFYLIIFAIANMTLPLSLFLG)
Functional MotifsPutative membrane-anchoring regions and potential signal peptides

Genomic Context in AFV2

AFV2’s 31.7-kb linear dsDNA genome contains eight ORFs homologous to lipothrixviruses, including ORF202. Unlike rudiviruses (e.g., SIRV2), AFV2 lacks inverted terminal repeats but features a 1,008-bp repeat-rich region near its center, hypothesized as a replication origin . ORF202 is not directly linked to known structural genes (e.g., coat proteins or tail fibers) but may contribute to viral assembly or host interaction.

Expression and Purification Parameters

ORF202 is expressed in E. coli as a His-tagged fusion protein for purification. Key specifications include:

ParameterDetail
TagN-terminal His tag for nickel affinity chromatography
Purity>90% (SDS-PAGE-verified)
StorageLyophilized powder stored at -20°C/-80°C; working aliquots at 4°C
ReconstitutionDeionized sterile water (0.1–1.0 mg/mL); glycerol (5–50%) for long-term stability

Hypothetical Roles

While no direct functional studies on ORF202 are reported, bioinformatics and structural analogs suggest potential roles:

  1. Membrane Anchoring: Transmembrane domains may stabilize viral particles or facilitate host cell entry.

  2. Regulatory Functions: Homologs in related viruses (e.g., SIRV2’s ORF98) mediate egress via pyramidal structures, but ORF202’s role remains uncharacterized .

  3. Interactions: Putative binding motifs could mediate interactions with host proteins or viral components .

Experimental Applications

ORF202 is used in structural biology and virology studies:

  • Structural Analysis: Crystallization and NMR to resolve transmembrane topology.

  • Immunoassays: ELISA-based detection in serological or diagnostic research .

  • Functional Screens: Testing for interactions with archaeal host proteins or replication machinery .

Challenges and Knowledge Gaps

  1. Limited Functional Data: No experimental evidence links ORF202 to specific viral processes (e.g., replication, packaging, or host immune evasion).

  2. Genomic Complexity: AFV2’s repetitive genomic regions and intron-containing tRNA genes complicate ORF functional assignment .

  3. Host-Specificity: ORF202’s interactions with Acidianus host proteins remain unexplored.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific requirements for the format, please indicate them in your order remarks. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
ORF202; Putative transmembrane protein ORF202
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-202
Protein Length
full length protein
Species
Acidianus filamentous virus 2 (isolate Italy/Pozzuoli) (AFV-2)
Target Names
ORF202
Target Protein Sequence
MNTHYLTINLLRAIAFGLAYSILEVNVPLFHYIPVVDYRVFYLIIFAIANMTLPLSLFLG NFFLSMASEDMFYWIIKAQTPFQYAWYYPVIDGIPIADVIEVIISVFSYYYYVRHHNETT NIFHFIFVDTDNTSSSQQQQCGMWYAFTHGKAHDEYGALTLVLVSVLAILSSHSLSLTAF ATLSLIVGTGIFVDLWAHCFHH
Uniprot No.

Target Background

Database Links

KEGG: vg:5656056

Subcellular Location
Host membrane; Multi-pass membrane protein.

Q&A

What is the biological significance of the putative transmembrane protein ORF202 in Acidianus filamentous virus 2 (AFV2)?

The putative transmembrane protein ORF202 plays a crucial role in the structural and functional biology of the Acidianus filamentous virus 2 (AFV2). AFV2 is a double-stranded DNA virus belonging to the hyperthermophilic archaeal genus Acidianus. It is classified under the family Lipothrixviridae, which includes filamentous viruses with unique terminal and core structures. ORF202, as a putative transmembrane protein, is hypothesized to contribute to the structural integrity of the viral envelope and may facilitate interactions with host cell membranes during viral adsorption or entry processes .

How can researchers experimentally characterize the structure of ORF202?

To experimentally characterize the structure of ORF202, researchers can employ a combination of biochemical, biophysical, and computational techniques:

  • Protein Expression and Purification: Recombinant ORF202 can be expressed in a heterologous system such as E. coli or baculovirus-infected insect cells. The protein can then be purified using affinity chromatography techniques, particularly if it carries a His-tag as described in commercially available preparations .

  • Circular Dichroism (CD) Spectroscopy: CD spectroscopy can be used to determine the secondary structure content of ORF202, providing insights into its alpha-helical or beta-sheet composition.

  • X-ray Crystallography or Cryo-Electron Microscopy (Cryo-EM): High-resolution structural determination can be achieved through X-ray crystallography or Cryo-EM. These methods require crystallization or vitrification of the purified protein.

  • Nuclear Magnetic Resonance (NMR) Spectroscopy: For smaller proteins or domains of ORF202, NMR spectroscopy can provide detailed atomic-level structural information.

  • Computational Modeling: In silico methods such as homology modeling or molecular dynamics simulations can predict the three-dimensional structure of ORF202 based on its amino acid sequence and known structures of homologous proteins.

  • Functional Assays: To correlate structure with function, researchers can perform lipid-binding assays or reconstitute ORF202 into artificial lipid bilayers to study its membrane-interacting properties.

These approaches collectively enable a comprehensive understanding of the structural features and potential functions of ORF202.

What are the challenges in studying hyperthermophilic archaeal viruses like AFV2?

Studying hyperthermophilic archaeal viruses such as AFV2 presents several challenges:

  • Host Cultivation: The natural host of AFV2, Acidianus species, thrives under extreme conditions (e.g., high temperatures around 75°C and low pH levels). Maintaining these conditions in laboratory settings requires specialized equipment and expertise .

  • Low Viral Yield: The production of AFV2 virions in culture may be limited due to non-lytic replication cycles and stable carrier states within host cells . This complicates large-scale purification efforts.

  • Protein Stability: Proteins from hyperthermophilic organisms are adapted to function at high temperatures but may exhibit reduced stability under mesophilic conditions commonly used in experimental setups.

  • Genomic Complexity: The genome of AFV2 contains unique features such as repeat-rich regions and intron-containing tRNA genes . These elements complicate genomic annotation and functional analyses.

  • Lack of Genetic Tools: Genetic manipulation systems for hyperthermophilic archaea are less developed compared to bacterial or eukaryotic systems, limiting functional studies on viral-host interactions.

To overcome these challenges, researchers often employ innovative techniques such as metagenomics for viral discovery, synthetic biology for genome reconstruction, and thermostable enzymes for molecular biology applications.

How does ORF202 compare to other transmembrane proteins in archaeal viruses?

ORF202 exhibits both similarities and differences when compared to other transmembrane proteins found in archaeal viruses:

  • Conserved Features: Like other viral transmembrane proteins, ORF202 likely contains hydrophobic domains that span lipid bilayers, facilitating its integration into viral envelopes . These domains are essential for maintaining virion stability under extreme environmental conditions.

  • Unique Characteristics: Unlike transmembrane proteins from mesophilic viruses, those from hyperthermophilic archaeal viruses like AFV2 must withstand high temperatures and acidic environments. This adaptation may result in unique amino acid compositions or post-translational modifications that enhance thermal stability .

  • Functional Divergence: While many viral transmembrane proteins mediate host cell entry by interacting with surface receptors or facilitating membrane fusion, the exact role of ORF202 remains speculative due to limited experimental data. Its function may extend beyond membrane interactions to include roles in virion assembly or intracellular trafficking.

Comparative studies involving sequence alignment and structural modeling can provide additional insights into these similarities and differences.

What experimental strategies can be used to investigate the interaction between ORF202 and host cell membranes?

Investigating interactions between ORF202 and host cell membranes requires a multidisciplinary approach:

  • Liposome Binding Assays: Reconstituting ORF202 into artificial liposomes composed of archaeal lipids can help assess its binding affinity and specificity for membrane components.

  • Surface Plasmon Resonance (SPR): SPR can quantify real-time interactions between purified ORF202 and immobilized lipid molecules or membrane proteins from Acidianus species.

  • Fluorescence Microscopy: Labeling ORF202 with fluorescent tags allows visualization of its localization during infection processes using confocal microscopy.

  • Mutagenesis Studies: Site-directed mutagenesis targeting conserved residues within hydrophobic domains can identify key amino acids involved in membrane interactions.

  • Host Cell Mutants: Generating mutant strains of Acidianus lacking specific membrane components can reveal potential receptors or co-factors required for ORF202-mediated attachment.

These strategies not only elucidate the mechanistic basis of ORF202-host interactions but also contribute to our understanding of viral entry processes in extreme environments.

What is known about the genomic context of ORF202 within AFV2?

The genomic context of ORF202 within AFV2 provides valuable clues about its potential functions:

  • Genomic Organization: The AFV2 genome spans approximately 31,787 base pairs and contains multiple open reading frames (ORFs), including ORF202 . These genes are arranged linearly with minimal intergenic regions, reflecting compact genome organization typical of archaeal viruses.

  • Regulatory Elements: Promoter motifs resembling TATA boxes and Shine-Dalgarno sequences have been identified upstream of several genes, including those near ORF202 . These elements suggest transcriptional regulation mechanisms adapted to archaeal host machinery.

  • Functional Clustering: Genes encoding structural proteins are often clustered together in viral genomes to facilitate coordinated expression during virion assembly . If ORF202 is part of such a cluster, it may indicate its involvement in envelope formation or stabilization.

  • Repeat-Rich Regions: The presence of repeat-rich regions near certain genes suggests potential roles in genome replication or recombination events . While no direct association with ORF202 has been reported, these features highlight the genomic complexity of AFV2.

Further studies combining transcriptomics with proteomics are needed to map gene expression patterns and validate predicted functions for ORF202 within this genomic framework.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.