Recombinant Acidianus two-tailed virus Putative transmembrane protein ORF119

What is the Acidianus two-tailed virus (ATV) and why is ORF119 significant?

The Acidianus two-tailed virus (ATV) is a remarkable archaeal virus belonging to the Bicaudaviridae family that infects extremophilic Acidianus species living in high-temperature (80-95°C), acidic (pH 1.5-2.5) environments . What makes ATV particularly fascinating is its unique morphological development, wherein it undergoes extracellular and host-independent transformation by growing long tails at each end of the spindle-shaped virion . The putative transmembrane protein ORF119 is one of the viral proteins that may play a role in the viral structure or host interaction processes. Understanding this protein could provide insights into the unusual biology of archaeal viruses and their adaptation to extreme environments .

What are the basic structural characteristics of ATV ORF119?

ATV ORF119 is a full-length protein consisting of 119 amino acids with the following sequence: MGLAPSLATLAIALVFLGISLIFLVPAMVQGLYSIVSGVFSVASSVSNETGCPQSTEVVQLSNQTASISVPSQYAGIYTLYLSFISFVGSIFTDPIALIMLILVSLIITLFAFYYKNQG . Bioinformatic analysis suggests that it functions as a transmembrane protein, with hydrophobic regions that likely span the lipid bilayer. The protein contains multiple predicted transmembrane helices, which is consistent with its putative role as a membrane-associated protein. The arrangement of these domains suggests it may function in membrane anchoring, transport, or cell signaling during viral infection .

What expression systems are most effective for recombinant ATV ORF119 production?

The most well-documented expression system for recombinant ATV ORF119 is E. coli, as evidenced by the commercially available recombinant protein . For optimal expression, the protein can be fused with an N-terminal His-tag to facilitate purification. When designing an expression strategy, researchers should consider:

• Codon optimization for the expression host

• Use of inducible promoter systems (e.g., T7 or lac)

• Appropriate fusion tags to enhance solubility and purification

• Growth temperature modulation (often lower temperatures improve membrane protein folding)

For membrane proteins like ORF119, specialized E. coli strains designed for membrane protein expression (such as C41/C43 or Lemo21) may yield better results than standard laboratory strains .

What purification strategies yield the highest quality recombinant ORF119?

Purification of recombinant ORF119 typically employs the following methodological approach:

• Affinity chromatography using Ni-NTA resin to capture the His-tagged protein

• Detergent solubilization of membrane fractions (critical for transmembrane proteins)

• Size exclusion chromatography for further purification

• Buffer optimization with stabilizing agents

The purified protein can achieve greater than 90% purity as determined by SDS-PAGE . For optimal results, researchers should maintain appropriate detergent concentrations throughout the purification process to prevent protein aggregation while preserving native structure. The final product is typically stored as a lyophilized powder or in a Tris/PBS-based buffer containing 6% trehalose at pH 8.0 .

What are the optimal storage conditions for maintaining ORF119 stability?

Based on established protocols, the following storage conditions are recommended for recombinant ORF119:

• Long-term storage: -20°C to -80°C with 50% glycerol as a cryoprotectant

• Working aliquots: 4°C for up to one week

• Lyophilized powder: -20°C with minimal exposure to moisture

Repeated freeze-thaw cycles should be avoided as they can significantly reduce protein activity and structural integrity . When reconstituting the lyophilized protein, it should be dissolved in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with the addition of 5-50% glycerol for stability during storage . Proper centrifugation of the vial before opening ensures that all material is collected at the bottom of the container.

What is the hypothesized function of ORF119 in the ATV life cycle?

While the exact function of ORF119 has not been definitively established, its predicted transmembrane nature suggests several possible roles:

• Virion structural component: It may serve as an integral part of the viral envelope

• Host entry mediator: The protein could participate in receptor binding or membrane fusion

• Morphogenesis factor: It might contribute to the remarkable extracellular tail development that characterizes ATV

Research on related archaeal viruses suggests that transmembrane proteins often play crucial roles in host recognition and viral assembly . The unique extracellular development of ATV tails involves specialized proteins, and while p618 (a MoxR-type AAA ATPase) and p892 (a von Willebrand domain A-containing cochaperone) have been implicated in tail formation, ORF119 could potentially contribute to this process or to the initial virion structure .

How can researchers investigate protein-protein interactions involving ORF119?

To investigate potential interaction partners of ORF119, researchers can employ several complementary approaches:

• Yeast two-hybrid screening: Particularly useful for identifying binary interactions, though challenging for membrane proteins

• Pull-down assays: Using the His-tagged recombinant protein as bait to capture interaction partners

• Co-immunoprecipitation: With antibodies specific to ORF119

• Proximity labeling: Techniques such as BioID or APEX2 to identify proteins in the vicinity of ORF119 during infection

• Cross-linking mass spectrometry: To capture transient or weak interactions

Previous studies on ATV proteins have identified interaction networks involving other viral proteins. For example, researchers have shown that proteins p618, p387, p653, p800, and p892 interact with each other, forming a potential chaperone system involved in tail development . A similar methodological approach could be applied to investigate whether ORF119 participates in these or other protein complexes.

What experimental approaches can validate the predicted transmembrane topology of ORF119?

To experimentally validate the transmembrane topology predictions, researchers can employ:

• Protease protection assays: Determining which regions are accessible to proteases when the protein is inserted into a membrane

• Cysteine scanning mutagenesis: Introducing cysteine residues at various positions and testing their accessibility to membrane-impermeable reagents

• Fluorescence resonance energy transfer (FRET): Measuring distances between domains

• Cryo-electron microscopy: For structural characterization in a membrane environment

• Reporter fusion assays: Fusing reporter proteins to different domains and assessing their localization

How might ORF119 contribute to the unique morphological development of ATV tails?

The extracellular tail development of ATV represents one of the most unusual features among all known viruses . While preliminary research has implicated proteins such as p618 (a MoxR-type AAA ATPase) and p892 (a VWA-containing cochaperone) in this process, the potential role of ORF119 remains unexplored. As a transmembrane protein, ORF119 could potentially:

• Serve as an anchoring point for the assembly of tail proteins

• Facilitate conformational changes needed for tail extension

• Participate in protein-protein interactions with known tail development factors

• Contribute to the structural integrity of the developing tails

To investigate this, researchers could employ targeted gene knockout or mutation studies, followed by electron microscopy to observe any impacts on tail morphogenesis. Additionally, immunogold labeling could determine the localization of ORF119 during different stages of tail development .

What role might ORF119 play in host recognition and specificity?

ATV specifically infects Acidianus hosts adapted to extreme acidic, high-temperature environments . Viral transmembrane proteins often serve as determinants of host range and specificity. To investigate whether ORF119 contributes to host recognition:

• Receptor identification assays: Using purified ORF119 to identify potential binding partners on Acidianus cell surfaces

• Competition assays: Testing whether excess recombinant ORF119 can inhibit viral infection

• Comparative analysis: Studying sequence variations in ORF119 across different ATV isolates with varying host ranges

• Host-range expansion experiments: Assessing whether mutations in ORF119 alter host specificity

This research would contribute to understanding the molecular determinants of host-virus interactions in extremophilic archaea and potentially reveal evolutionary adaptations to extreme environments.

How does ORF119 compare to transmembrane proteins in other archaeal viruses?

Comparative analysis between ORF119 and transmembrane proteins from other archaeal viruses could provide evolutionary insights and functional predictions. Key approaches include:

• Sequence homology analysis: Identifying conserved motifs or domains

• Structural modeling: Comparing predicted structures with known viral transmembrane proteins

• Phylogenetic analysis: Establishing evolutionary relationships

• Functional complementation: Testing whether ORF119 can substitute for transmembrane proteins in other viral systems

Of particular interest would be comparing ORF119 with proteins from the related bicaudavirus STSV1, which develops a single tail intracellularly rather than the extracellular double-tail formation characteristic of ATV . This comparison could highlight the molecular determinants of different tail development strategies.

What analytical techniques are most appropriate for studying ORF119 structure?

Due to the challenges inherent in membrane protein structural analysis, researchers should consider multiple complementary approaches:

• X-ray crystallography: Challenging but potentially achievable with appropriate detergents or lipidic cubic phase methods

• Nuclear magnetic resonance (NMR): Particularly suitable for detecting dynamic regions and ligand interactions

• Cryo-electron microscopy: Increasingly powerful for membrane protein structure determination

• Circular dichroism spectroscopy: For secondary structure analysis

• Computational modeling: Using existing structural databases and homology modeling

Previous structural genomics approaches with other archaeal viral proteins have yielded valuable insights, including the identification of unexpected functional domains . Similar approaches applied to ORF119 could reveal structural features that inform function.

How can researchers develop effective tools for tracking ORF119 during infection?

To monitor ORF119 during the viral infection cycle, researchers can develop:

• Specific antibodies: For immunofluorescence, Western blotting, and immunoprecipitation

• Fluorescently tagged versions: If tolerated without disrupting function

• Reporter constructs: Fusing portions of ORF119 to reporter proteins

• qPCR assays: To monitor gene expression timing

• Mass spectrometry methods: For quantitative proteomics during infection

These approaches would help determine the temporal and spatial dynamics of ORF119 during infection. Previous studies have used dual viral and cellular fluorescence in situ hybridization (viral FISH) to study host-virus interactions in environmental samples, and similar techniques could be adapted for ORF119 research .

What challenges might researchers face when investigating ORF119 interactions with host membranes?

Studying interactions between viral transmembrane proteins and host membranes presents several methodological challenges:

• Extreme culture conditions: Acidianus hosts require high temperature (80-95°C) and acidic pH (1.5-2.5), complicating real-time observations

• Membrane composition differences: Archaeal membranes differ significantly from bacterial or eukaryotic membranes

• Limited genetic tools: Fewer established genetic manipulation techniques for extremophilic archaea

• Protein stability issues: High temperatures can affect protein-protein interactions and assay reliability

Researchers can address these challenges through:

• Development of archaeal-specific membrane mimetics for in vitro studies

• Adaptation of experimental conditions to accommodate extreme pH and temperature requirements

• Use of environmental samples and culture-independent approaches for certain analyses

• Careful control experiments to distinguish specific from non-specific membrane interactions