Recombinant Acidianus two-tailed virus Structural protein ORF187

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested. Advance notification is required for dry ice shipping, and additional fees will apply.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The specific tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Structural protein ORF187
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-187
Protein Length
full length protein
Species
Acidianus two-tailed virus (ATV)
Target Protein Sequence
MSTTFDKDQENEQQQQDAQAIWKKILSPGARITKDDVDFAIDNLESAPDVPYEFMYATFS PNAKIYQPTAIAVSGVGGIIGALLALKRALQYGGPKYYVTTEEVIKATDQKSPLYLANYA LNRLLKAYPAQVVVIKPDDFDKIKTLLSSGGVYISGLPYETLIPISQLSGFGRIWHYSPI QKKFFVF
Uniprot No.

Target Background

Database Links

KEGG: vg:4484233

Subcellular Location
Host membrane; Single-pass membrane protein. Virion.

Q&A

Basic Research Questions

Advanced Research Questions

  • How does ORF187 contribute to the unique extracellular tail development process in ATV, and what experimental approaches can elucidate this mechanism?

    While the exact role of ORF187 in ATV tail development remains to be fully elucidated, several experimental approaches can be employed to investigate its function:

    1. Time-course electron microscopy studies: Monitoring structural changes in purified virions with and without recombinant ORF187 addition during extracellular maturation at different timepoints (1 hour to several days) .

    2. Protein-protein interaction analysis: Pull-down assays and co-immunoprecipitation with other known ATV structural proteins, particularly the MoxR-type ATPase (ATV p618) and its co-chaperone which have been implicated in tail development .

    3. Mutagenesis studies: Site-directed mutagenesis targeting conserved domains within ORF187 to identify regions essential for tail formation .

    4. In vitro reconstitution experiments: Attempts to recreate aspects of the tail formation process using purified components including ORF187, ATV p618, and the intermediate filament-like protein ATV p800 .

    5. Cryo-electron tomography: Structural analysis of tail development intermediates to visualize ORF187 localization during the transformation process .

    Research on related viruses like ATSV (Acidianus tailed spindle virus) indicates that these spindle-shaped morphologies may involve "a metastable multistart helical assembly of variable radius that, through a remarkable transition to a more stable cylindrical assembly, could be used to drive genome ejection" . This mechanism might provide insights into ORF187's structural role.

  • What biophysical and structural characterization methods are most effective for analyzing ORF187's structure-function relationships?

    Comprehensive structural characterization of ORF187 requires multiple complementary approaches:

    1. X-ray crystallography: For high-resolution structural determination, similar to studies performed on ATV₂₇₃ . This requires:

      • Optimization of crystallization conditions (likely at acidic pH)

      • Consideration of thermostability during crystal growth

      • Phase determination strategies (molecular replacement may be challenging due to novel folds)

    2. Small-angle X-ray scattering (SAXS): For solution-state analysis of oligomeric state and molecular envelope, particularly useful for thermostable proteins that may form tetramers like other ATV structural proteins .

    3. Cryo-electron microscopy: Single-particle analysis and tomography to visualize ORF187 in the context of intact virions, providing insights into its spatial arrangement .

    4. Circular dichroism spectroscopy: To analyze secondary structure stability across temperature and pH ranges relevant to ATV's natural environment .

    5. Differential scanning calorimetry: For precise determination of thermal transition points and stability characteristics .

    These approaches should be integrated with computational structural predictions and comparative analyses with other archaeal viral structural proteins to fully understand ORF187's unique properties and functional contributions to ATV architecture.

  • How can researchers study potential interactions between ORF187 and host cell receptor proteins?

    Investigating ORF187's potential role in host cell recognition requires specialized approaches for extremophilic virus-host systems:

    1. Pull-down experiments: Similar to methods used for ATV p529, which identified interaction with Sso1273 (OppASs), an N-linked glycoprotein that specifically binds oligopeptides . This approach involves:

      • Expression of recombinant ORF187 with affinity tags

      • Incubation with cell extracts from potential host species (Acidianus convivator and related Sulfolobales)

      • Mass spectrometry identification of binding partners

    2. Surface plasmon resonance (SPR): For quantitative binding kinetics analysis between purified ORF187 and candidate host cell receptors, modified to accommodate extreme pH and temperature conditions .

    3. Viral FISH combined with cellular markers: Following the methodology used for ATSV host identification, dual fluorescence in situ hybridization can visualize viral-host interactions and potential ORF187 localization during attachment .

    4. Yeast two-hybrid screening: Modified for archaeal proteins to identify potential binding partners in host organisms .

    5. Competitive binding assays: Using recombinant ORF187 to inhibit virus attachment to host cells, quantifying the degree to which it may interfere with infection .

    These approaches should consider the oligopeptide/dipeptide ABC transporter system that appears to be conserved among Sulfolobales as a potential receptor recognition mechanism for tailed-fusiform viruses .

  • What comparative proteomic approaches can distinguish the function of ORF187 from related structural proteins in other archaeal viruses?

    Comparative proteomic analysis between ORF187 and structural proteins from related archaeal viruses can provide functional insights:

    1. Cross-species structural alignment: Comparing ORF187 with structural proteins from:

      • Acidianus tailed spindle virus (ATSV) major coat protein (MCP)

      • STSV1 coat protein

      • Other Bicaudaviridae family members

    2. Conserved domain analysis: Identifying functional motifs that may be present across multiple archaeal virus structural proteins, particularly focusing on:

      • Thermostability determinants (salt bridges, hydrophobic packing)

      • DNA-binding domains

      • Oligomerization interfaces

    3. Functional complementation assays: Testing whether ORF187 can functionally replace structural proteins in related viruses through genetic engineering approaches .

    4. Evolutionary analysis: Phylogenetic studies of structural proteins across archaeal viruses to identify evolutionary relationships and functional divergence .

    5. Interactome mapping: Comparing the network of protein-protein interactions for ORF187 versus structural proteins from other archaeal viruses to identify shared and unique binding partners .

    These approaches should be interpreted with consideration for the unique extracellular tail development in ATV compared to single-tailed viruses like ATSV, which may reflect fundamental differences in structural protein function despite sequence similarities .

  • What are the challenges and solutions in analyzing ORF187's role in the context of ATV's complete virion architecture?

    Studying ORF187 within ATV's complete architecture presents several challenges:

    1. Heterogeneity in virion morphology: ATV particles show variability in dimensions and tail development stages, complicating structural studies .

      • Solution: Cryo-electron tomography combined with sub-tomographic averaging to analyze particles at defined maturation stages .

    2. Limited host cultivation systems: Working with extremophilic Acidianus hosts presents technical challenges .

      • Solution: Culture-independent approaches for virus characterization directly from environmental samples .

    3. Complex virion composition: Multiple structural proteins with potential functional overlap .

      • Solution: Systematic depletion and complementation studies using recombinant proteins .

    4. Dynamic structural transitions: The extracellular transition from spindle-shaped to tailed morphology involves complex protein rearrangements .

      • Solution: Time-resolved structural studies using multiple biophysical techniques .

    5. Novel protein folds: Many ATV structural proteins including ORF187 may have unique folds without close homologs in structural databases .

      • Solution: Integrated experimental and computational approaches for ab initio structure determination .

    Recent advances in cryo-electron tomography and single-particle analysis offer promising approaches to overcome these challenges, potentially "allowing density-based placement of the crystallographic structure into the viral capsid, addressing many of the unresolved details" .

  • How can researchers effectively design expression and purification strategies for studying ORF187 interactions with other ATV structural proteins?

    Designing optimal strategies for studying ORF187 protein-protein interactions requires:

    1. Co-expression systems: Developing polycistronic expression constructs for simultaneous production of ORF187 with other ATV structural proteins in appropriate stoichiometry .

    2. Controlled denaturation-renaturation approaches: Enabling reconstruction of protein complexes under conditions mimicking the extreme environment where ATV naturally assembles .

    3. Tag optimization strategies: Evaluating different affinity tag positions and cleavage options to minimize interference with protein-protein interactions .

    4. In vitro assembly assays: Developing conditions that promote the formation of higher-order structures from purified components .

    5. Chemical crosslinking coupled with mass spectrometry: For capturing transient interactions during assembly or structural transitions .

    ApproachAdvantagesLimitationsOptimization Strategies
    Co-expressionNatural stoichiometry, co-foldingComplex optimizationUse of chaperones, temperature control
    Pull-down assaysDirect detection of complexesMay miss weak interactionsMultiple buffer conditions, crosslinking
    In vitro assemblyControlled conditionsMay not replicate in vivo processGradual pH and temperature transitions
    Crosslinking-MSCaptures transient statesChemical modification may alter functionTitration of crosslinker concentrations
    Fluorescence-based assaysReal-time monitoringRequires labelingStrategic placement of fluorophores

    These approaches should be informed by the existing knowledge of ATV assembly, particularly the proposed model involving "a metastable multistart helical assembly of variable radius that, through a remarkable transition to a more stable cylindrical assembly, could be used to drive genome ejection" .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.