Recombinant Acidianus two-tailed virus Uncharacterized protein ORF529

Shipped with Ice Packs
In Stock

Description

General Information

Acidianus two-tailed virus (ATV) Uncharacterized protein ORF529 is a protein derived from the Acidianus two-tailed virus, an archaeal virus known for its unique morphology. The ATV virus infects the archaeon Sulfolobus solfataricus . ORF529 is one of the 96 open reading frames within the ATV genome . Due to it being an uncharacterized protein, its precise function is not yet fully understood, but research suggests potential roles in viral processes, such as host cell receptor recognition and DNA cleavage .

Basic characteristics

CharacteristicDescription
Full NameRecombinant Full Length Acidianus Two-Tailed Virus Uncharacterized Protein Orf529 Protein
SourceE. coli
SpeciesAcidianus Two-Tailed Virus (ATV)
UniProt IDQ3V4U3
Amino Acid Length529
Molecular Weightapproximately 59 kDa
TagHis-tagged
PurityGreater than 90% as determined by SDS-PAGE
FormLyophilized powder
Storage BufferTris/PBS-based buffer with 6% Trehalose, pH 8.0
Storage ConditionsStore at -20°C/-80°C upon receipt, avoid repeated freeze-thaw cycles
ReconstitutionReconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL; addition of 5-50% glycerol is recommended for long-term storage
Amino Acid SequenceMFFKNLFPFSIMGGICRKVVLSPTSLFIPTNGDTITADGQEVLFAYPNNCLFVKDLTKVVRNKTIIQEKKYDENHYIIYYDNKELFLPKQIWEPVKSAVNAFIEKGYLDGGILLYGAPGMGKSELAKLISKWLGIGMIQKRADDIMSKYLGESEQNMARLFKEEIPQNLPTIVFMDEVDWLGVRRRFGSTTADTASTTVGQILTVFLQLFQDEVIEKRLPVLFIATTNARLEDLDDAFKRRF PFKIYFTPPSQEMIEYFTDKYIKKTGKDTFVVHGKQLSKKQFVNFIVGTGISIAEFKT LLETQSFDSISSSSTYLRRVIPADIPEKVFDATRVKLNGYISFNCDDFNGRTKFHVASFP WISWAILGSYIMLQCKKPIFELLPTDNLSVEELVSGLKQYEPTFFLMFSSSRDDYRLAIL ASRLKRERGIDVVFFSEDNKLFPESVMLTPYYDISNISFVNEEEKKQLIDTVIHFYGVEA KPDELNILISSRIKGGNSTSDFLNSLQTYILAKSKITDTEKVKDVVKLY

Functional Studies of ATV p529

Research on the AAA ATPase p529 of ATV provides some functional context. The protein p529 has two structural domains: an N-terminal domain with ATPase activity and a C-terminal domain exhibiting Mg(2+)-dependent endonuclease activity .

  • The N-terminal domain carries ATPase activity, with an optimum temperature of 60°C. It also exhibits DNA binding activity, which is weakened in the presence of ATP .

  • The C-terminal domain functions as a Mg(2+)-dependent endonuclease, which can be eliminated via site-directed mutagenesis at a conserved catalytic motif .

  • P529 interacts with Sso1273, corresponding to OppA(Ss), an N-linked glycoprotein that specifically binds oligopeptides. The sso1273 gene is part of an operon encoding an oligopeptide/dipeptide ABC transporter system .

  • It is proposed that p529 is involved in ATV-host cell receptor recognition. The endonuclease activity may be required for the cleavage of the circular viral DNA before cell entry .

Potential Involvement in Viral Infection

Based on the functional studies, ORF529 likely plays a crucial role in the Acidianus two-tailed virus's infection mechanism . The ATPase activity and DNA binding properties of the N-terminal domain, along with the endonuclease activity of the C-terminal domain, suggest a coordinated mechanism for host cell entry and DNA processing . The interaction with host proteins like Sso1273 further supports its role in host-virus interactions .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
Uncharacterized protein ORF529
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-529
Protein Length
full length protein
Species
Acidianus two-tailed virus (ATV)
Target Protein Sequence
MFFKNLFPFSIMGGICRKVVLSPTSLFIPTNGDTITADGQEVLFAYPNNCLFVKDLTKVV RNKTIIQEKKYDENHYIIYYDNKELFLPKQIWEPVKSAVNAFIEKGYLDGGILLYGAPGM GKSELAKLISKWLGIGMIQKRADDIMSKYLGESEQNMARLFKEEIPQNLPTIVFMDEVDW LGVRRRFGSTTADTASTTVGQILTVFLQLFQDEVIEKRLPVLFIATTNARLEDLDDAFKR RFPFKIYFTPPSQEMIEYFTDKYIKKTGKDTFVVHGKQLSKKQFVNFIVGTGISIAEFKT LLETQSFDSISSSSTYLRRVIPADIPEKVFDATRVKLNGYISFNCDDFNGRTKFHVASFP WISWAILGSYIMLQCKKPIFELLPTDNLSVEELVSGLKQYEPTFFLMFSSSRDDYRLAIL ASRLKRERGIDVVFFSEDNKLFPESVMLTPYYDISNISFVNEEEKKQLIDTVIHFYGVEA KPDELNILISSRIKGGNSTSDFLNSLQTYILAKSKITDTEKVKDVVKLY
Uniprot No.

Target Background

Database Links

KEGG: vg:4484273

Subcellular Location
Host membrane; Single-pass membrane protein.

Q&A

What is Acidianus two-tailed virus and where was it discovered?

Acidianus viruses belong to a family of archaeal viruses that infect hyperthermophilic archaea of the genus Acidianus. These remarkable viruses have been isolated from extreme environments, particularly acidic hot springs. For instance, the Acidianus Tailed Spindle Virus (ATSV) was identified in a high-temperature (80°C) acidic (pH 2) hot spring located in Yellowstone National Park . Similar viruses, like AFV1, have been isolated from other thermal habitats and characterized using metagenomic approaches followed by detailed molecular analysis .

The host organisms, Acidianus species, are facultatively aerobic archaea that grow using elemental sulfur as an energy source. Several species, including Acidianus hospitalis, Acidianus infernus, and Acidianus ambivalens, have been identified as hosts for these viruses . Acidianus sp. strain HS-5, which was isolated from a sulfur hot spring in Unzen, Japan, represents another potential host for archaeal viruses in this ecosystem .

How is ORF529 characterized within the viral genome?

ORF529 would be characterized through comprehensive genomic analysis similar to other archaeal viral proteins. First, the complete viral genome would be sequenced using a combination of short-read and long-read sequencing technologies, as demonstrated in the characterization of Acidianus sp. strain HS-5, which utilized Illumina NovaSeq for short-read sequencing and MinION for long-read sequencing .

Following genome assembly, ORF prediction would identify potential coding regions, including ORF529. Analysis would include:

  • Determining the exact position and length of the ORF within the viral genome

  • Identifying potential promoter sequences and Shine-Dalgarno motifs that suggest expression

  • Analyzing T-rich sequences downstream that could serve as transcriptional terminators

  • Determining if the ORF is part of an operon structure

Similar analyses of the AFV1 genome revealed 40 ORFs when the size limit was lowered to 48 amino acids, with approximately 75% preceded by putative promoter sequences and 60% preceded by Shine-Dalgarno sequences . This methodical approach would help position ORF529 within the viral genetic context.

What are the predicted structural features of ORF529?

Structural prediction of ORF529 would involve several bioinformatic approaches:

  • Primary sequence analysis: Examining amino acid composition for hydrophobic regions, signal peptides, and transmembrane domains

  • Secondary structure prediction: Using algorithms to predict α-helices, β-sheets, and random coils

  • Tertiary structure modeling: Applying homology modeling if similar proteins exist or ab initio modeling if the protein is unique

  • Domain identification: Searching for conserved domains that might suggest function

When analyzing uncharacterized viral proteins, researchers often look for unique structural features that might indicate specific functions. For example, in ATSV, researchers identified a three-domain gene product containing an N-terminal leucine-rich repeat domain, followed by a likely posttranslation regulatory region with high serine and threonine content, and a C-terminal ESCRT-III domain . Such structural analysis provides valuable insights into potential protein functions and interactions with host systems.

What are the optimal methods for expressing recombinant ORF529 in laboratory conditions?

Expressing recombinant proteins from hyperthermophilic archaeal viruses presents unique challenges due to their extreme native conditions. Here's a methodological approach:

Expression System Selection:

Expression SystemAdvantagesLimitationsSuitability for ORF529
E. coliHigh yield, well-established protocolsMay not fold properly at mesophilic temperaturesRequires optimization of temperature and folding
Yeast systemsBetter for complex proteins with post-translational modificationsSlower growth than bacteriaGood alternative if E. coli fails
Archaeal hostsNative-like conditionsMore challenging to grow and manipulateBest for functional studies

Optimization Protocol:

  • Clone the ORF529 gene into a vector with a compatible promoter and a heat-stable selection marker

  • Transform into the chosen expression system

  • Test expression under various conditions:

    • Temperature (30-80°C)

    • Induction conditions (if using inducible promoters)

    • Media composition (particularly sulfur content)

  • Verify expression using SDS-PAGE and Western blotting

  • Optimize purification protocols based on predicted protein properties

For hyperthermophilic proteins, expression often requires balancing between the thermostability of the protein and the growth conditions of the expression host. Temperature-controlled induction and the addition of chaperones might be necessary to achieve proper folding .

How can researchers effectively purify ORF529 for structural and functional studies?

Purification of ORF529 would require a tailored approach based on its biochemical properties:

Step-by-Step Purification Protocol:

  • Cell Lysis: For hyperthermophilic proteins, heat treatment (70-80°C) can be used as an initial purification step, as it denatures most mesophilic host proteins while leaving the thermostable target protein intact.

  • Chromatography Selection: Based on predicted properties of ORF529:

    • Affinity chromatography (if expressed with a tag)

    • Ion exchange chromatography (based on predicted pI)

    • Hydrophobic interaction chromatography

    • Size exclusion chromatography for final polishing

  • Specialized Techniques: For archaeal viral proteins, density gradient centrifugation is often employed:

    • CsCl gradient centrifugation at high speeds (238,000 × g)

    • Collection and screening of gradient fractions using qPCR

    • Concentration with molecular weight cutoff filters (e.g., 100,000-MWCO)

  • Quality Control:

    • SDS-PAGE analysis to verify purity

    • Mass spectrometry to confirm identity

    • Dynamic light scattering to assess homogeneity

    • Circular dichroism to verify proper folding

For studies requiring intact viral particles containing ORF529, researchers can follow protocols similar to those used for AFV1, which involved precipitation with polyethylene glycol 6000 and 1 M NaCl from cell-free supernatant, followed by isopycnic gradient centrifugation in CsCl .

What assays are recommended for determining the enzymatic activity of ORF529?

Without specific knowledge of ORF529's function, a systematic approach to enzymatic characterization would include:

Initial Functional Screening:

  • In silico prediction: Use bioinformatic tools to predict potential enzymatic functions based on sequence similarity, conserved domains, and structural predictions.

  • Broad-spectrum activity screening:

    • Nuclease activity (DNA/RNA degradation assays)

    • Protease activity (peptide substrate assays)

    • DNA/RNA binding assays (electrophoretic mobility shift assay)

    • ATPase/GTPase activity (phosphate release assays)

    • Interactions with host proteins (pull-down assays)

  • Host-interaction studies: Since many viral proteins interact with host systems, investigate:

    • Interactions with the ESCRT system (if ESCRT domains are present)

    • Membrane binding assays (if hydrophobic regions are identified)

    • Host transcription/translation machinery interactions

Enzymatic Activity Characterization:

Once potential activity is identified, characterize:

  • Substrate specificity

  • Optimal temperature (likely 70-90°C for Acidianus virus proteins)

  • pH optimum (likely acidic range pH 2-4)

  • Metal ion requirements

  • Kinetic parameters (Km, Vmax)

Since archaeal viruses often have proteins involved in sulfur metabolism, specific assays targeting sulfur compound transformation might be relevant, similar to those used for studying Acidianus sp. strain HS-5, which possesses genes like phsA, doxAD, sor, sqr, and sreABCDE .

How should researchers interpret proteomic data for ORF529 and distinguish it from host proteins?

Proteomic analysis of ORF529 requires careful differentiation from host proteins, especially in the context of viral infection. Here's a methodological approach:

Sample Preparation and Analysis:

  • Prepare paired samples of infected and uninfected host cells

  • Extract proteins from both samples

  • Perform quantitative proteomics using techniques like iTRAQ (isobaric tags for relative and absolute quantitation)

  • Process the data using statistical methods to identify differentially expressed proteins

Data Interpretation Strategy:

Data TypeAnalysis ApproachExpected Patterns for Viral Proteins
Expression timingTime-course analysisAppearance after infection, following viral replication cycle
Abundance changesFold-change analysisSignificant upregulation post-infection
LocalizationCell fractionationCompartment-specific enrichment
InteractomeCo-immunoprecipitationInteractions with specific host proteins

Advanced Analysis Techniques:

  • Similar to the approach used in ORFV-infected cells, where 10,630 peptides and 2,776 proteins were detected, with 282 differentially expressed (222 upregulated, 60 downregulated)

  • Classify proteins by function (e.g., cell killing, proliferation, biological adhesion)

  • Identify pathways affected by viral infection

  • Look for patterns in protein families (e.g., heat shock proteins, ribosomal proteins)

By comparing the proteomic profiles and focusing on proteins that appear only in infected samples, researchers can confidently identify and characterize ORF529 in its native context .

What bioinformatic approaches are most effective for predicting the function of ORF529?

Predicting the function of an uncharacterized protein like ORF529 requires a multi-layered bioinformatic approach:

Sequence-Based Analysis:

  • Homology searches: Using BLASTP, PSI-BLAST, and HHpred against multiple databases

  • Motif identification: Using PROSITE, PFAM, and SMART to identify functional motifs

  • Ortholog analysis: Identifying related proteins in other archaeal viruses

  • Conservation mapping: Identifying highly conserved residues that might be functionally important

Structure-Based Prediction:

  • Structural homology: Using tools like Phyre2 or I-TASSER for structure prediction

  • Binding site prediction: Identifying potential active sites or binding pockets

  • Molecular dynamics simulations: Exploring potential conformational changes

  • Protein-protein interaction prediction: Identifying potential binding partners

Functional Annotation:

  • Gene neighborhood analysis: Examining nearby genes in the viral genome for context

  • Gene Ontology (GO) term prediction: Assigning potential biological processes and molecular functions

  • Pathway mapping: Using tools like KEGG Mapper to place the protein in potential metabolic or signaling pathways

  • Subcellular localization prediction: Determining where the protein likely functions

This comprehensive approach has been effective for viral proteins from Acidianus and other archaeal hosts. For example, the genome of Acidianus sp. strain HS-5 was analyzed using BlastKOALA and KofamKOALA to retrieve KEGG ortholog numbers, followed by pathway prediction using KEGG Mapper . This approach revealed complete sets of genes for key metabolic pathways and identified genes involved in sulfur metabolism.

How can researchers determine if ORF529 interacts with host cellular machinery?

Determining host-virus protein interactions is crucial for understanding viral replication and pathogenicity. Here's a systematic approach:

Experimental Methods for Interaction Studies:

  • Affinity Purification-Mass Spectrometry (AP-MS):

    • Express tagged ORF529 in host cells

    • Perform pull-down experiments

    • Identify interacting partners by mass spectrometry

    • Compare to control pull-downs to eliminate false positives

  • Yeast Two-Hybrid (Y2H) or Bacterial Two-Hybrid:

    • Screen ORF529 against a library of host proteins

    • Validate positive interactions with secondary assays

  • Co-immunoprecipitation (Co-IP):

    • Generate antibodies against ORF529

    • Immunoprecipitate the protein complex from infected cells

    • Identify interacting partners by Western blot or mass spectrometry

  • Proximity Labeling:

    • Express ORF529 fused to BioID or APEX2

    • Allow proximity-dependent labeling of nearby proteins

    • Purify and identify labeled proteins

Data Analysis and Validation:

  • Create interaction networks using tools like Cytoscape

  • Validate key interactions using multiple methods

  • Perform functional assays to determine the consequences of interactions

  • Map interactions to specific domains of ORF529

Analyzing host-viral protein interactions has revealed important insights in related systems. For example, some archaeal viral proteins interact with the host ESCRT system, as suggested by the identification of an ESCRT-III domain in an ATSV protein . Similarly, proteomic analysis of virus-infected cells can reveal changes in host proteins involved in cell killing, proliferation, and biological adhesion, providing clues about viral manipulation of host processes .

How does ORF529 contribute to viral replication and host-virus interactions in extreme environments?

Understanding the role of ORF529 in viral replication in extreme environments requires sophisticated approaches that account for the unique conditions of Acidianus habitats:

Research Methodology:

  • Temperature and pH-controlled assays:

    • Study protein activity and stability at 70-90°C and pH 2-4

    • Compare wild-type virus with ORF529 mutants (if genetic systems are available)

    • Monitor viral replication kinetics using qPCR under various conditions

  • Host-range determination:

    • Test viral infection across multiple Acidianus species and strains

    • Correlate ORF529 sequence variations with host specificity

    • Similar to approaches used for AFV1, which was found to infect several strains of A. hospitalis (YS8, YS9, W1-6) and A. infernus, but not A. ambivalens or A. brierleyi

  • Infection cycle analysis:

    • Determine latent period and virus release patterns

    • Quantify intracellular viral DNA at different time points

    • Monitor host growth curves during infection

    • Map expression timing of ORF529 during infection

The latent period for archaeal viruses like AFV1 has been determined to be approximately 4 hours post-infection by monitoring decreases in intracellular viral DNA through Southern hybridization experiments . Similar approaches could reveal how ORF529 fits into the viral replication cycle.

For studying viral replication in extreme environments, specialized equipment maintaining high temperatures and low pH is essential, as these conditions are critical for both host metabolism and viral protein function.

What structural adaptations in ORF529 enable function in extreme thermoacidophilic conditions?

The extreme conditions of high temperature (70-90°C) and low pH (2-4) in which Acidianus viruses operate necessitate special adaptations in viral proteins:

Structural Analysis Approaches:

  • Comparative structural analysis:

    • Compare ORF529 with mesophilic homologs if available

    • Identify unique features associated with thermostability

    • Map acidic residue distribution and compare with non-acidophilic proteins

  • Thermostability determinants:

    • Increased proportion of charged amino acids (especially Glu and Lys)

    • Higher number of salt bridges and hydrogen bonds

    • Compact hydrophobic core

    • Reduced loop regions and surface area

    • Higher content of branched amino acids (Ile, Val, Leu)

  • Acid stability features:

    • Reduced number of acid-labile bonds

    • Modified surface charge distribution

    • Protective structural elements around acid-sensitive moieties

Experimental Verification:

  • Circular dichroism spectroscopy at different temperatures and pH values

  • Differential scanning calorimetry to determine melting temperature

  • Site-directed mutagenesis of predicted key residues

  • Structural determination at extreme conditions (if possible)

Understanding these adaptations could provide insights into protein engineering for extreme conditions and might reveal novel structural features unique to archaeal virus proteins.

How can researchers utilize ORF529 for potential biotechnological applications in extreme conditions?

The extreme stability and unique functions of archaeal viral proteins make them valuable for biotechnological applications:

Potential Applications:

  • Enzyme development for industrial processes:

    • Biocatalysts for high-temperature industrial processes

    • Acid-stable enzymes for bioprocessing

    • Novel activities for bioremediation of acidic environments

  • Protein engineering platforms:

    • Scaffold proteins for designing thermostable enzymes

    • Structure-guided design of proteins with enhanced stability

    • Identification of critical residues for thermostability

  • Analytical tools:

    • Development of heat-stable molecular biology reagents

    • Components for diagnostics designed to function in harsh conditions

    • Stable protein-based biosensors

Research and Development Pathway:

Development StageKey ActivitiesMethods
CharacterizationDetermine precise function and structureX-ray crystallography, cryo-EM, functional assays
OptimizationEnhance desired propertiesDirected evolution, rational design
Application testingValidate in industrial conditionsScaled-up testing, stability assays
Process integrationIncorporate into industrial processesImmobilization, process engineering

For reproducible development of such applications, researchers would need to follow structured experimental designs similar to those used in bench-scale cell growth and productivity studies . This would include careful control of environmental variables, standardized protocols, and robust statistical analysis to ensure that the observed properties are consistent and scalable.

What evolutionary insights can be gained from studying ORF529 in the context of archaeal virus evolution?

Studying ORF529 in an evolutionary context can provide valuable insights into archaeal virus origins and adaptations:

Evolutionary Analysis Approaches:

  • Phylogenetic analysis:

    • Construct phylogenetic trees based on ORF529 and homologs

    • Compare with phylogenies of other viral genes and host species

    • Identify potential horizontal gene transfer events

  • Molecular clock analysis:

    • Estimate divergence times for ORF529 variants

    • Correlate with geological events or host evolution

    • Determine rates of evolution in extreme environments

  • Structural evolution:

    • Track conservation of domains and motifs across archaeal viruses

    • Identify functional constraints through selection pressure analysis

    • Map structural innovations unique to thermoacidophilic viruses

Evolutionary Insights:

  • Understanding the origins of hyperthermophilic viral adaptations

  • Tracing the co-evolution of virus and host in extreme environments

  • Identifying ancient viral protein functions that have been conserved

This evolutionary perspective is particularly valuable for archaeal viruses, as they represent some of the most ancient viral lineages and often contain unique genes not found in other viruses. For example, the study of Acidianus filamentous virus 1 (AFV1) revealed a linear genome with terminal inverted repeats, suggesting distinct evolutionary origins or mechanisms compared to other viruses .

What are the major challenges in working with recombinant proteins from extremophilic archaeal viruses?

Working with recombinant proteins from extremophilic archaeal viruses presents several unique challenges:

Technical Challenges and Solutions:

ChallengeDescriptionSolution Strategies
Expression in mesophilic hostsPotential toxicity, improper folding, inclusion body formationUse specialized expression strains, lower induction temperature, fusion with solubility tags
Maintaining native conformationProteins evolved for extreme conditions may not fold properly in standard lab conditionsInclude stabilizing additives, develop refolding protocols, use in vitro translation systems
Activity assaysStandard assays may not work at extreme temperatures and pHDevelop modified assay formats, use thermostable reagents, specialized equipment for high-temperature reactions
Structural analysisTraditional structural biology methods may be limited at extreme conditionsAdapt cryo-EM and X-ray crystallography methods, use molecular dynamics simulations
Genetic manipulationLimited genetic tools for many archaeal hostsDevelop new genetic systems, use heterologous expression, CRISPR-based approaches

Methodological Considerations:

When working with Acidianus viral proteins like ORF529, researchers must adapt protocols for high-temperature and low-pH conditions. For instance, purification methods might include heat treatment steps (70-80°C) to eliminate mesophilic contaminants, as described in protocols for isolating archaeal viruses . Additionally, specialized equipment such as high-temperature incubators, acid-resistant materials, and modified buffer systems are essential for maintaining protein stability and activity.

What emerging technologies could advance our understanding of ORF529 and similar archaeal virus proteins?

Several cutting-edge technologies hold promise for advancing research on archaeal viral proteins:

Emerging Technologies and Applications:

  • Cryo-electron microscopy advancements:

    • Single-particle analysis at near-atomic resolution

    • Visualizing proteins in their native viral context

    • Capturing different conformational states

    • Potential for visualizing virus-host interactions at the molecular level

  • Integrative structural biology approaches:

    • Combining X-ray crystallography, NMR, and cryo-EM data

    • Molecular dynamics simulations at extreme conditions

    • Computational modeling of protein-protein interactions

    • Hydrogen-deuterium exchange mass spectrometry for protein dynamics

  • Advanced genomic and transcriptomic tools:

    • Long-read sequencing for complete viral genomes

    • RNA-seq under extreme conditions to map expression patterns

    • CRISPR-Cas systems adapted for archaeal hosts

    • Single-cell approaches to study virus-host interactions

  • Specialized biophysical methods:

    • High-temperature adaptations of common biophysical assays

    • In situ studies within simulated extreme environments

    • Microfluidic systems for high-throughput screening under extreme conditions

    • Advanced imaging techniques for visualizing infection in archaeal hosts

These technologies could significantly enhance our understanding of how proteins like ORF529 function in extreme environments and interact with their hosts, potentially revealing unique mechanisms not seen in mesophilic systems .

How might comparative studies between ORF529 and similar proteins in other archaeal viruses enhance our understanding of archaeal virology?

Comparative studies provide powerful insights into the evolution and function of viral proteins:

Comparative Research Framework:

  • Cross-species comparison:

    • Compare ORF529 with homologs from other Acidianus viruses (like ATSV and AFV1)

    • Extend comparison to other archaeal viruses (Sulfolobus viruses, Pyrococcus viruses)

    • Identify conserved domains versus variable regions

    • Correlate protein features with host range and environmental adaptations

  • Structure-function relationships:

    • Compare protein structures across different archaeal virus families

    • Identify common structural motifs despite sequence divergence

    • Correlate structural features with specific environmental adaptations

    • Map functional domains to understand modular evolution

  • Host interaction networks:

    • Compare how different viral proteins interact with conserved host systems

    • Identify common targets in host metabolism

    • Understand diverse strategies for manipulating similar host processes

    • Trace the evolution of virus-host interactions

Expected Insights:

This comparative approach could reveal how different archaeal viruses have evolved unique solutions to common challenges posed by extreme environments. For example, comparing virus morphologies and protein components between filamentous viruses like AFV1 and tailed spindle viruses like ATSV could illuminate diverse viral adaptation strategies . Such comparisons might also identify core functions essential to all archaeal viruses versus specialized adaptations unique to specific viral families or environmental niches.

What protocols and resources are most valuable for researchers working with ORF529?

This comprehensive methodology resource table provides researchers with essential protocols and resources for studying ORF529:

Research AreaMethodologyProtocol SourceSpecial Considerations
Virus IsolationCsCl density gradient centrifugationProtocol similar to AFV1 isolation: PEG precipitation followed by gradient centrifugation at 1.3 g/ml Maintain acidic pH and high temperature during purification
Genome SequencingCombined short-read and long-read sequencingIllumina NovaSeq (2×150 bp) and Oxford Nanopore MinION with R9 flow cell Ensure DNA extraction method is suitable for high GC content
Protein ExpressionHeterologous expression in E. coli with specialized vectorsThermo-adapted expression systems with temperature-inducible promotersConsider fusion with thermostable tags; expression at elevated temperatures
Protein PurificationHeat treatment followed by column chromatographyHeat precipitation (70-80°C) followed by affinity chromatographyUse buffers stable at acidic pH; include stabilizing additives
Structural AnalysisX-ray crystallography and cryo-EMStandard crystallization with adaptations for thermophilic proteinsCrystal screening at elevated temperatures; specialized cryo-EM grids
Functional AssaysActivity assays at elevated temperaturesCustom assays maintaining 70-80°C and pH 2-4Use thermostable reagents; specialized equipment for maintaining extreme conditions
Proteomic AnalysisiTRAQ or TMT labeling and LC-MS/MSProtocols similar to those used for ORFV-infected cells Include appropriate controls for distinguishing viral from host proteins
Bioinformatic ResourcesSequence and structure prediction toolsKEGG Mapper, BlastKOALA, KofamKOALA Use specialized databases for archaeal proteins

This resource table provides a starting point for researchers, summarizing methodologies that have proven effective in studying related archaeal viruses and their proteins. Adapting these protocols for the specific characteristics of ORF529 will be essential for successful research outcomes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.