Recombinant Acidiphilium cryptum ATP synthase subunit a (atpB)

Shipped with Ice Packs
In Stock

Description

Introduction to Acidiphilium cryptum ATP Synthase

Acidiphilium cryptum is an acidophilic α-proteobacterium thriving in acidic, metal-rich environments, such as coal mine drainage systems . Its metabolic versatility includes heterotrophic growth and adaptation to extreme pH conditions. ATP synthase, a critical enzyme for cellular energy production, consists of multiple subunits, with subunit a (encoded by atpB) playing an essential role in proton translocation across membranes. Recombinant production of this subunit enables detailed biochemical and structural studies.

Recombinant Acidiphilium cryptum ATP Synthase Subunit a (atpB)

Recombinant Acidiphilium cryptum ATP synthase subunit a (atpB) is a 238-amino acid protein (UniProt ID: Q7CND5) produced via heterologous expression in Escherichia coli. This full-length protein includes an N-terminal hexahistidine (His) tag for purification . Key features include:

PropertyDetails
Catalog NumberRFL6435SF
Source OrganismAcidiphilium cryptum
Expression HostEscherichia coli
TagN-terminal His tag
Purity>85% (verified by SDS-PAGE)
Storage Conditions-20°C (short-term); -80°C (long-term)

Genomic Context and Sequence Features

The atpB gene is part of the atp operon, which in many bacteria follows the order atpIBEFHAGDC. Subunit a (atpB) is integral to the membrane-bound F<sub>O</sub> sector, facilitating proton channeling during ATP synthesis . The recombinant protein retains the native sequence (1–238aa) with the following characteristics:

Sequence FeatureValue
Length238 amino acids
Molecular Weight~26.9 kDa (calculated)
Isoelectric Point (pI)Predicted 9.3 (ExPASy ProtParam)
Dominant ResiduesHydrophobic regions consistent with transmembrane helices

Production and Purification Methodology

The recombinant subunit is synthesized in E. coli using plasmid vectors under tetracycline-inducible promoters (e.g., pASK-IBA3) . Post-induction with anhydrotetracycline (AHT), cells are lysed, and the protein is purified via immobilized metal affinity chromatography (IMAC) leveraging the His tag . Yield and activity are optimized under low-salt conditions compatible with A. cryptum’s native enzyme kinetics .

Applications in Research

  • Mechanistic Studies: Used to dissect proton translocation mechanisms in extremophilic ATP synthases .

  • Biotechnological Engineering: Serves as a template for designing acid-stable bioenergy systems .

  • Drug Discovery: Targeted in studies exploring ATP synthase inhibitors for antimicrobial development .

Comparative Analysis with Other Subunits

SubunitGeneFunctionRecombinant Production
Subunit aatpBProton channel formationFull-length, His-tagged in E. coli
Subunit αatpACatalytic nucleotide bindingPartial sequences expressed
Subunit BatpF1Stabilization of F<sub>1</sub>-F<sub>O</sub> interfaceHis-tagged in E. coli

Future Research Directions

  • Cryo-EM Studies: High-resolution structural analysis to map proton pathways.

  • Chimeric Enzymes: Engineering hybrid ATP synthases for industrial biocatalysis.

  • Stress Response: Investigating subunit a’s role in A. cryptum’s adaptation to heavy metals .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please include it in your order notes. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary based on the purchasing method and location. For precise delivery estimates, please consult your local distributor.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. You may use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
atpB; Acry_0397; ATP synthase subunit a; ATP synthase F0 sector subunit a; F-ATPase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-251
Protein Length
full length protein
Species
Acidiphilium cryptum (strain JF-5)
Target Names
atpB
Target Protein Sequence
MAQESGINALGQFQLTTGFGAFGKAIEFTNSNEMMLLAAVIVTSLFVVALRQRALVPGRM QGLAEISYEFVHNMVLDTIGEEGKRFFPFVFTLFAFILIGNILGLFPYFFAFTSHIAITG ALALFVFALSTLVGFWYHGIGFLKFFSPPGVPGWLLPLLIPIEIVSFLSRPISLSVRLFA NITAGHVMWEVFAGFMLMLVSGLGAVGVVAAIIPLGLNIALTALEFLVAFLQAYVFAILT CLYLHDAIHMH
Uniprot No.

Target Background

Function
This protein is a key component of the proton channel, playing a direct role in the translocation of protons across the membrane.
Database Links
Protein Families
ATPase A chain family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of ATP synthase subunit a (atpB) in Acidiphilium cryptum?

The subunit a (atpB) in A. cryptum is a critical component of the F0 portion of the F1F0-ATP synthase complex. It forms part of the membrane-embedded proton channel that facilitates proton movement across the membrane. In acidophiles like A. cryptum, this subunit plays a crucial role in maintaining ATP synthesis under acidic conditions, containing specific adaptations that prevent proton leakage.

Unlike neutrophilic organisms, the A. cryptum subunit a contains amino acid substitutions that allow it to function optimally at low pH, contributing to the organism's ability to maintain a proton gradient sufficient for ATP synthesis despite growing in environments with pH as low as 2-3 .

How does the genomic organization of the atpB gene differ in Acidiphilium compared to other bacteria?

In Acidiphilium species, the ATP synthase genes show specific genomic organization patterns that reflect their evolutionary adaptation to acidic environments. Comparative genomic analysis reveals that Acidiphilium has an "open" pangenome fitted into a power-law regression function [Ps(n) = 3,533.18n0.375395], while the core genome follows an exponential regression [Fc(n) = 2,725.11e-0.073314n] .

This open pangenome structure suggests that Acidiphilium species have undergone considerable gene exchange to extend their functional profiles, potentially affecting ATP synthase components. The atpB gene in Acidiphilium is typically part of an ATP synthase operon that shows specific adaptations compared to neutrophilic bacteria, particularly in regulatory regions that may respond to pH fluctuations.

What are the optimal expression conditions for recombinant Acidiphilium cryptum ATP synthase subunit a?

Based on successful expression of other proteins from A. cryptum, the following conditions have proven effective for recombinant expression:

Table 1. Optimized Expression Conditions for Recombinant A. cryptum ATP Synthase Subunit a

ParameterOptimal ConditionNotes
Expression hostE. coli C41(DE3) or C43(DE3)"Walker strains" better tolerate membrane protein expression
Vector systempASK-IBA3 with tet promoterAllows tight regulation with anhydrotetracycline (AHT)
Induction temperature16-20°CLower temperatures improve proper folding
Inducer concentration200 ng/ml AHT or 0.1-0.2 mM IPTGLower concentrations often yield better results for membrane proteins
Growth mediaM9 minimal media with glycerolSlower growth promotes proper folding; glycerol has shown high efficiency for A. cryptum proteins
Induction OD6000.6-0.8Mid-log phase provides balance between cell density and expression efficiency
Expression duration16-24 hoursExtended expression at lower temperatures

The specific production of A. cryptum proteins in E. coli has been characterized by high specific production rates of up to 345 mg/(g dcw × h) when utilizing glycerol as a carbon source at low salt conditions (≤0.5% NaCl) .

How do acidophile-specific motifs in A. cryptum ATP synthase subunit a compare with those of other extremophiles?

ATP synthase subunit a from acidophiles like A. cryptum contains specific structural adaptations that distinguish it from other extremophiles. While alkaliphiles require motifs that prevent excessive proton entry into the cell, A. cryptum needs motifs that regulate controlled proton flow into the cytoplasm without cytoplasmic acidification.

Studies of alkaliphile-specific motifs in ATP synthase a-subunits provide a comparative framework for understanding acidophile adaptations. In Stenotrophomonas sp. isolated from the alkaline Lonar Lake, specific motifs in the a-subunit enable function at high pH . By contrast, A. cryptum likely contains inverse adaptations, with residue substitutions that maintain function at low pH instead.

The A. cryptum ATP synthase shows adaptation to acidic conditions while maintaining less acidic proteins internally, similar to what has been observed with its hydroxyectoine biosynthesis proteins, which differ from halophilic variants by their less acidic nature and optimal activity in the absence of salt .

What role does horizontal gene transfer play in the evolution of ATP synthase components in Acidiphilium species?

Comparative genomic analysis of Acidiphilium species reveals extensive evidence of horizontal gene transfer (HGT) events affecting various metabolic pathways. The analysis of 12 Acidiphilium strains showed that their pangenome possessed 8,845 gene families, while the core genome contained only 1,422 gene families, accounting for just 16.1% of the pangenome .

This genomic flexibility suggests that ATP synthase components, including the atpB gene, may have been subject to HGT events during Acidiphilium evolution. The "open" pangenome structure indicates significant gene exchange that has extended the functional profiles of these organisms , potentially conferring advantages for survival in acidic environments through the acquisition of specialized ATP synthase subunits.

How can structural studies of A. cryptum ATP synthase inform acid-stable bioenergetic systems?

Structural characterization of A. cryptum ATP synthase subunit a could provide valuable insights for designing acid-resistant bioenergetic systems with applications in biotechnology. The natural acid adaptation mechanisms employed by this protein could serve as templates for engineering synthetic enzymes capable of functioning under acidic conditions.

This approach parallels work with other A. cryptum proteins, such as the hydroxyectoine biosynthesis enzymes, which have been successfully utilized for efficient heterologous production in E. coli due to their adaptation to function optimally at low pH . The unique biochemical properties of these non-halophilic enzymes from A. cryptum enabled unprecedented carbon source conversion rates of approximately 60% of the theoretical maximum when expressed in E. coli .

Table 2. Potential Applications of A. cryptum ATP Synthase Structural Features

Structural FeaturePotential ApplicationAdvantage
Proton channel architectureBiomimetic proton conductorsEnhanced function in acidic conditions
Acid-stable protein-protein interfacesEngineered protein complexesStability in industrial acidic processes
Surface amino acid compositionProtein surface engineeringImproved folding and stability at low pH
Transmembrane domain organizationSynthetic membrane proteinsControlled proton flux in acidic environments
Conformational flexibilityBiomolecular machinesMaintained functionality across pH ranges

What are the best protocols for purifying recombinant A. cryptum ATP synthase subunit a while maintaining its activity?

Purification of membrane proteins like ATP synthase subunit a requires specialized approaches to maintain structural integrity and function. Based on successful purification of other acidophilic membrane proteins, the following protocol is recommended:

  • Membrane Extraction: Harvest cells and disrupt using French press or sonication in buffer containing 50 mM MES (pH 6.0), 100 mM NaCl, 10% glycerol, and protease inhibitors.

  • Detergent Solubilization: Solubilize membranes using a mild detergent screen:

Table 3. Recommended Detergent Screening for A. cryptum ATP Synthase Subunit a

DetergentWorking ConcentrationAdvantagesConsiderations
DDM (n-Dodecyl-β-D-maltoside)1-1.5% for extraction, 0.05% for purificationWidely successful for ATP synthasesMay destabilize some protein-protein interactions
LMNG (Lauryl maltose neopentyl glycol)0.5-1% for extraction, 0.01% for purificationHigher stability than DDMMore expensive
Digitonin1-2% for extraction, 0.1% for purificationVery mild, preserves native interactionsPoor solubility, natural product variability
Brij-350.5-1%Effective for acidophile proteinsLimited literature for ATP synthases
C12E80.5-1%Good for retaining activityHigher CMC requires careful monitoring
  • Affinity Purification: For His-tagged constructs, use Ni-NTA resin with buffers containing the selected detergent at concentrations above CMC. Include 10-20% glycerol and consider using slightly acidic buffers (pH 5.5-6.5) to better mimic native conditions.

  • Size Exclusion Chromatography: As a final polishing step, use size exclusion chromatography with buffers containing appropriate detergent concentrations to remove aggregates and ensure homogeneity.

  • Activity Preservation: Throughout purification, maintain samples at 4°C and include stabilizing agents such as glycerol (10-20%) and potentially specific lipids like cardiolipin that are important for ATP synthase function.

This approach has proven successful for membrane proteins from acidophiles and should be adaptable to A. cryptum ATP synthase subunit a.

How can we accurately measure the activity of recombinant A. cryptum ATP synthase subunit a in vitro?

Functional characterization of ATP synthase subunit a requires specialized assays that can detect its role in proton translocation. The following methodological approaches are recommended:

  • Liposome Reconstitution: Reconstitute purified subunit a together with other ATP synthase components into liposomes with a lipid composition mimicking the A. cryptum membrane. A mixture of E. coli polar lipids supplemented with cardiolipin (10-20%) has proven effective for other bacterial ATP synthases.

  • Proton Pumping Assays: Encapsulate pH-sensitive fluorescent dyes (ACMA or pyranine) in proteoliposomes to directly monitor proton translocation. Establish a pH gradient and monitor fluorescence changes in response to ATP addition.

  • ATP Synthesis/Hydrolysis Coupling: Measure ATP synthesis rates when an artificial proton gradient is applied across the proteoliposome membrane. Conversely, measure proton pumping driven by ATP hydrolysis.

  • pH Dependency Profiling: Characterize activity across a pH range (2.0-7.0) to determine pH optima and compare with neutrophilic ATP synthases. This approach helped characterize the A. cryptum hydroxyectoine biosynthesis enzyme EctC, demonstrating its optimal activity in the absence of salt .

  • Inhibitor Sensitivity: Use specific ATP synthase inhibitors (oligomycin, DCCD, venturicidin) to confirm that measured activity stems from properly assembled ATP synthase complexes.

Successful implementation of these methodologies has been demonstrated for other membrane proteins from acidophiles and should be applicable to A. cryptum ATP synthase subunit a.

What expression systems are most suitable for producing high yields of functional A. cryptum ATP synthase subunit a?

Based on successful heterologous expression of other A. cryptum proteins, several expression systems show promise:

  • E. coli-based Systems: Modified E. coli strains like C41(DE3) or C43(DE3) have shown success with membrane proteins. For A. cryptum proteins specifically, plasmids based on the pASK-IBA3 vector with a tet promoter have enabled high expression levels after induction with anhydrotetracycline (AHT) .

  • Induction Conditions: Lower temperatures (16-20°C) and reduced inducer concentrations often yield higher amounts of properly folded membrane proteins. For A. cryptum proteins, expression in minimal media with glycerol as carbon source has proven highly effective .

  • Carbon Source Considerations: When expressing A. cryptum proteins in E. coli, utilizing glycerol as a carbon source at low salt conditions (≤0.5% NaCl) has resulted in remarkable specific production rates of up to 345 mg/(g dcw × h) with carbon source conversion rates of approximately 60% of the theoretical maximum .

  • Codon Optimization: Codon optimization for E. coli can improve expression levels, especially for membrane proteins with rare codons that might otherwise limit translation efficiency.

  • Co-expression Strategies: Co-expression with chaperones (GroEL/GroES) or other ATP synthase subunits can improve folding and assembly. For A. cryptum proteins, co-expression of multiple genes from the same pathway has proven successful, as demonstrated with the hydroxyectoine biosynthesis gene cluster .

Table 4. Expression Vector Options for A. cryptum ATP Synthase Subunit a

Vector SystemPromoterKey FeaturesDemonstrated Success with A. cryptum Proteins
pASK-IBA3tetTight regulation, high expression after AHT inductionYes, used successfully for expression of A. cryptum proteins
pET seriesT7Strong expression, IPTG inductionYes, with modifications (lower temperature, reduced IPTG)
pBAD seriesaraBADTitratable expression with arabinoseLimited data, but promising for toxic proteins
pRARE (co-expression)-Supplies rare tRNAs to overcome codon biasCan be used with other expression vectors
pASK_ectABCDasktetSuccessfully used for A. cryptum gene clustersDemonstrated for hydroxyectoine production

How can A. cryptum ATP synthase subunit a be used as a model for studying extremophile adaptations?

A. cryptum ATP synthase subunit a serves as an excellent model system for studying molecular adaptations to acidic environments. Unlike many other acidophiles, A. cryptum has a relatively moderate acid tolerance (up to pH 2) while maintaining internal pH near neutral, making it an ideal system for studying the transition between acidophilic and neutrophilic adaptations.

This approach has proven valuable with other A. cryptum proteins. For example, the hydroxyectoine biosynthesis proteins from A. cryptum differ from halophilic variants by their less acidic nature, implying optimum activity in the absence of salt . Similar studies with ATP synthase subunit a could reveal mechanisms of acid adaptation that could inform protein engineering for industrial applications.

Researchers can use comparative studies between A. cryptum ATP synthase and homologs from neutrophiles to identify specific residues and structural features responsible for acid adaptation. These insights may be applicable to other extremophile adaptations and protein engineering efforts.

What techniques are most effective for studying the assembly of recombinant A. cryptum ATP synthase complex?

Studying the assembly of the ATP synthase complex requires specialized techniques that can capture protein-protein interactions and complex formation:

  • Blue Native PAGE: This technique preserves protein-protein interactions and can visualize intact ATP synthase complexes. It has been successfully used to demonstrate the dissolution of ATP synthase complexes in other organisms, such as the shift from a ~900 kDa complex to smaller ~100 kDa subcomplexes observed when stator subunits are depleted .

  • Co-immunoprecipitation: Using tagged versions of ATP synthase subunits to pull down interaction partners from solubilized membranes has proven effective for identifying novel subunits in other organisms, as demonstrated in the identification of 11 previously unknown subunits from the Toxoplasma ATP synthase .

  • Mass Spectrometry Analysis: Affinity purification followed by mass spectrometry has successfully identified ATP synthase components in other organisms. This approach identified 209 proteins associated with tagged ATP synthase subunits in Toxoplasma, which were then filtered based on conservation patterns, co-regulation, and predicted contribution to parasite fitness to identify core components .

  • Fluorescence Microscopy: Fluorescently tagged subunits can reveal localization and potential assembly defects. This approach has shown that depletion of ATP synthase subunits can lead to aberrant mitochondrial morphology and decreased oxygen consumption .

Table 5. Comparison of Assembly Analysis Techniques for ATP Synthase Complexes

TechniqueInformation ProvidedAdvantagesLimitations
Blue Native PAGENative complex size, stabilityPreserves native interactions, visualizes subcomplexesLimited resolution of individual components
Mass SpectrometryComponent identification, stoichiometryComprehensive, unbiasedRequires careful filtering of results
Co-immunoprecipitationDirect interaction partnersIdentifies stable interactionsMay miss transient interactions
Fluorescence MicroscopyLocalization, morphological effectsIn vivo analysis possibleLimited resolution
Oxygen ConsumptionFunctional consequencesMeasures physiological impactIndirect measure of assembly

Studies in Toxoplasma showed that depletion of stator subunits led to aberrant mitochondrial morphology, decreased oxygen consumption, and disassembly of the ATP synthase complex , providing a methodological framework for similar studies with A. cryptum ATP synthase.

How does A. cryptum ATP synthase subunit a compare to homologs in other extremophiles?

Comparative analysis of ATP synthase subunit a across extremophiles reveals distinct adaptations to different environmental challenges:

Table 6. Comparison of ATP Synthase Adaptations Across Extremophiles

Organism TypeEnvironmental ChallengeATP Synthase AdaptationsRelevance to A. cryptum
Acidophiles (A. cryptum)Low external pH (2-3)Modified proton channel, acid-stable interfacesNative adaptations
Alkaliphiles (Stenotrophomonas sp.)High external pH (9-11)Specific motifs for function at high pH Inverse adaptations to similar challenges
ThermophilesHigh temperatureIncreased rigid structural elements, disulfide bondsDifferent stabilization strategy
HalophilesHigh salt concentrationIncreased acidic surface residuesA. cryptum proteins show less acidic nature
PsychrophilesLow temperatureIncreased flexibility, reduced hydrophobic coreMay share some flexibility features with A. cryptum

The ATP synthase a-subunit from Stenotrophomonas sp. isolated from alkaline Lonar Lake contains specific motifs enabling function at high pH , which provides a comparative framework for understanding the inverse adaptations in A. cryptum that allow function at low pH.

The less acidic nature of A. cryptum proteins, demonstrated in its hydroxyectoine biosynthesis enzymes , likely extends to its ATP synthase components, representing a specific adaptation that differs from both neutrophiles and other extremophiles like halophiles.

What can we learn from studying the evolution of ATP synthase subunit a across Acidiphilium species?

Evolutionary analysis of ATP synthase across Acidiphilium species provides insights into adaptation mechanisms and the role of horizontal gene transfer in extremophile evolution:

  • Pangenome Analysis: The "open" pangenome of Acidiphilium fitted into a power-law regression function [Ps(n) = 3,533.18n0.375395] indicates extensive gene exchange that has shaped the functional capabilities of these organisms .

  • Core vs. Accessory Genome: While the core genome of Acidiphilium contains only 1,422 gene families (16.1% of the pangenome) , ATP synthase components are likely part of this core set due to their essential function.

  • Horizontal Gene Transfer: The abundant repertoire of horizontally transferred genes in Acidiphilium genomes may have influenced the evolution of ATP synthase components, potentially through the acquisition of acid-adaptive features from other acidophiles.

  • Comparative Genomics: Analysis of ATP synthase genes across Acidiphilium species can reveal conservation patterns specific to acidophiles versus neutrophiles, highlighting key adaptations.

  • Functional Category Enrichment: Acidiphilium genomes show enrichment in specific COG categories, including category C (energy production and conversion) , which encompasses ATP synthase components, indicating their evolutionary importance.

This evolutionary analysis provides a framework for understanding how natural selection and horizontal gene transfer have shaped the ATP synthase complex in acidophiles, with potential applications for protein engineering and synthetic biology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.