Recombinant Acidiphilium cryptum Membrane protein insertase YidC (yidC)

Shipped with Ice Packs
In Stock

Description

Functional Overview of YidC Insertases

YidC is an essential membrane protein insertase responsible for the co-translational integration and folding of α-helical membrane proteins. Key features include:

  • Mechanism: Binds nascent polypeptides at the ribosome exit tunnel, facilitates transmembrane domain insertion, and acts as a chaperone during folding .

  • Structural Motifs: Five transmembrane helices (TM1–TM5) with a cytoplasmic α-helical hairpin and hydrophilic groove critical for substrate interaction .

  • Energy Independence: Operates without ATP hydrolysis, leveraging hydrophobic mismatch and membrane thinning to drive insertion .

Biochemical Characteristics

Based on homologs:

  • Molecular Weight: ~60 kDa (predicted from E. coli YidC: 61 kDa) .

  • Membrane Topology: Five transmembrane helices with cytoplasmic N-/C-termini .

  • Stability: Likely acid-tolerant, given A. cryptum’s growth at pH 1.9–5.9 .

Functional Predictions

  • Substrate Specificity: Potential preference for acid-stable membrane proteins (e.g., ion transporters in acidic environments) .

  • Insertion Efficiency: May require lipid thinning (~7–10 Å) at TM3/5 regions to accommodate substrates .

Research Gaps and Opportunities

  • Structural Data: No high-resolution structures or cryo-EM maps exist for A. cryptum YidC.

  • Expression Systems: Recombinant production in E. coli (as with N. oceani YidC ) could enable functional assays.

  • Acid Adaptation: Unique mechanistic insights may arise from studying YidC’s role in pH homeostasis .

Technical Considerations for Recombinant Production

ParameterRecommendationRationale
Host SystemE. coli C41(DE3) or Lemo21(DE3) for membrane protein expression .Minimizes toxicity; enhances solubility.
PurificationNi-NTA affinity chromatography (His-tag) ; detergent screening (e.g., DDM, LMNG) .Maintains structural integrity; prevents aggregation.
Activity AssaysSingle-molecule force spectroscopy or SecYEG-coexpression .Validates insertion kinetics and chaperone activity.

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will strive to fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein itself.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
yidC; Acry_2141; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-601
Protein Length
full length protein
Species
Acidiphilium cryptum (strain JF-5)
Target Names
yidC
Target Protein Sequence
MDNRRLLYSISISLVILVLFQVIASYVLPPPKKAPPHPATQTAQTQPVSGQPAPGVPAPS AVPPAAAPGGVAAKIPAGPRLAISTPLLRGSMSLVGARLDDLVLTRYHQTVKKTSPLVQL LSQAGTAKSYYVQFGWDAAPGSSLKVPGPDTVWTSSGGDLSPAHPVTLSWNNGAGVTFEL KLAVDRQYLFTVQQRVINHGAAAVEVYPWSRIRRDFLPEEPGSFTLHKGPIGVFHGTLHE MGYEGVKSGGKHPAAGDAPGTAYQTTNLGGWAGITGKYWLTALIPSQGREVIGAYRYLAD PGQPEHGGYQVDYMTAKPVDAAPGATASTTTHVFAGAKVLSILSHYETQYRIPLFERAID FGWFFFLTKPIFIALDYLAGVFGNMGVAIIVFTIGLKLVLFPLVRTSYRSMARMRAITPK VQALRERYKDDQMQQQKEIMALYKAEGVNPAAGCLPMLPQIPIFFSLYKVIFISIGMRHA PFVLWIHDLSAEDPTNIFNLFGLLPFHPSALSPFLHLGILPIIMGITMWGQQRLNPPPPD PTQAKMMQFMPVIFTFMLGRFAAGLVLYYCVNNTLTILQQWTIMRGTNAAPRAAANLNAK G
Uniprot No.

Target Background

Function
Essential for the insertion, proper folding, and complex formation of integral membrane proteins within the membrane. Involved in the integration of membrane proteins that insert both dependently and independently of the Sec translocase complex, as well as at least some lipoproteins. Contributes to the folding of multispanning membrane proteins.
Database Links
Protein Families
OXA1/ALB3/YidC family, Type 1 subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the fundamental role of YidC in bacterial membrane protein biogenesis?

YidC serves as a critical membrane protein insertase that facilitates the insertion of newly synthesized proteins into lipid membranes. It functions through two primary mechanisms: as part of the SecYEG-dependent complex where it aids in protein insertion, and independently as a standalone insertase. Additionally, YidC acts as a chaperone in protein folding processes, ensuring proper membrane protein integration and assembly . In Acidiphilium cryptum, this protein likely plays a similar role in maintaining membrane protein homeostasis in acidic environments.

How does the structure of YidC from Acidiphilium cryptum compare to YidC from other bacterial species?

While specific structural data for Acidiphilium cryptum YidC is limited, comparative analysis with well-characterized bacterial YidC proteins (particularly from E. coli) suggests conservation of key structural features. YidC typically contains a hydrophilic groove within its transmembrane (TM) domain that is essential for substrate interaction and insertion. This groove likely contains conserved charged residues, including an arginine that facilitates membrane protein insertion by interacting with the substrate's charged residues . The structural organization typically includes multiple transmembrane segments that form the substrate-binding pocket and insertion channel.

What expression systems are most effective for producing recombinant Acidiphilium cryptum YidC?

For recombinant expression of Acidiphilium cryptum YidC, E. coli-based expression systems have proven effective for producing membrane proteins from acidophilic organisms. When expressing YidC, considerations should include:

  • Using expression vectors with tunable promoters (like pBAD or pET series) to control expression levels

  • Selection of E. coli strains optimized for membrane protein expression (C41/C43)

  • Growth at moderate temperatures (20-28°C) to allow proper folding

  • Inclusion of specific chaperones to enhance folding efficiency

The cultivation of the source organism (Acidiphilium cryptum) requires acidic conditions (pH 2-3) using specialized media such as Medium 269 at 28°C as recommended for strain DSM 2389 .

What purification strategies are optimal for isolating functional Acidiphilium cryptum YidC?

Purification of functional YidC requires careful selection of detergents and buffer conditions. A recommended protocol includes:

StepProcedureCritical Parameters
1. Membrane extractionCell disruption followed by differential centrifugationBuffer pH 7.0-8.0 with protease inhibitors
2. SolubilizationDetergent treatment (DDM, LMNG, or GDN)1-2% detergent, 4°C, 1-2 hours
3. Affinity purificationNi-NTA for His-tagged YidC20-40 mM imidazole for washing, 250-300 mM for elution
4. Size exclusionGel filtration chromatographyBuffer with 0.05-0.1% detergent
5. Functional verificationProteoliposome reconstitutionE. coli polar lipids or synthetic mixtures

Notably, maintaining the protein in DDM has been successful for YidC studies, as demonstrated in affinity pulldown experiments examining YidC interactions .

How does the oligomeric state of YidC influence its function as a membrane protein insertase?

Recent research suggests that YidC may function as a dimer rather than a monomer, which contradicts earlier structural studies. Evidence for YidC dimerization comes from multiple experimental approaches:

  • BN-PAGE analysis of native vesicles showing higher molecular weight complexes

  • Fluorescence correlation spectroscopy revealing oligomeric states

  • Single-molecule fluorescence photobleaching observations

  • Crosslinking experiments demonstrating proximity between YidC subunits

The dimeric assembly of YidC appears to create an ion-conductive pore lined by conserved residues that interact with nascent chains. This structural arrangement suggests an alternative insertion mechanism where the substrate protein may pass through a central channel rather than sliding along the protein surface. The dimerization may enhance substrate recognition capacity and provide a protected environment for membrane insertion .

What computational approaches can be used to model YidC-substrate interactions during membrane insertion?

Computational modeling of YidC-substrate interactions has proven valuable for understanding insertion mechanisms. Recommended approaches include:

Computational MethodApplicationKey Advantages
Molecular DockingInitial substrate positioningPredicts binding poses and interaction hotspots
Equilibrium MDStability assessmentAnalyzes conformational changes and system stability
Non-equilibrium MDDynamic processesModels insertion pathways and energy barriers
Steered MDForce-assisted transitionsSimulates directed movement of substrates
AlphaFold PredictionsStructure generationProduces reliable structural models for poorly characterized systems

Studies have successfully employed molecular dynamics (MD) simulations to investigate YidC-mediated insertion, using both equilibrium and non-equilibrium approaches. For example, researchers created docking structures of Pf3 coat protein interacting with YidC to represent different stages of the insertion process, followed by MD simulations to track conformational changes . The combination of these computational methods provides insights into local and global structural changes, water dynamics within the hydrophilic groove, and substrate conformational adaptations during insertion.

How does the acidophilic nature of Acidiphilium cryptum influence the structure-function relationship of its YidC protein?

Acidiphilium cryptum thrives in highly acidic environments (pH 2-3), suggesting its membrane proteins, including YidC, have evolved specific adaptations. While direct experimental data on Acidiphilium cryptum YidC is limited, comparative analysis suggests:

  • Enhanced stability at low pH through increased intramolecular interactions

  • Modified surface charge distribution to maintain function in acidic conditions

  • Altered hydrophilic groove properties to accommodate substrate insertion at low pH

  • Potentially modified lipid interactions to maintain membrane integrity in acidic environments

These adaptations likely influence substrate specificity and insertion efficiency. Researchers studying Acidiphilium cryptum YidC should consider the native acidic environment when designing experimental conditions, particularly during functional assays. Comparative studies with YidC from neutrophilic bacteria could reveal important insights into acid-adaptive mechanisms.

How does YidC interact with other membrane protein biogenesis factors in Acidiphilium cryptum?

Recent research has identified YibN as a significant interactor of YidC with implications for membrane protein integration. Co-expression studies and in vitro assays demonstrate that YibN enhances the production and membrane insertion of YidC substrates, including:

  • M13 and Pf3 phage coat proteins

  • ATP synthase subunit c

  • Various small membrane proteins like SecG

YibN was identified through proximity-dependent biotin labeling (BioID) and confirmed by affinity purification-mass spectrometry assays on native membranes. The physical interaction between YidC and YibN was further validated using on-gel binding assays with purified proteins .

Additionally, YidC interacts with the Sec translocon, aiding in the proper folding of multi-pass membrane proteins. This interaction creates a complex network of protein biogenesis factors that collectively maintain membrane proteostasis.

What are the methodological approaches for studying YidC-mediated insertion kinetics?

Studying the kinetics of YidC-mediated insertion requires sophisticated biophysical techniques. Recommended approaches include:

TechniqueMeasurementExperimental Design
FRETReal-time insertionDonor-acceptor pairs on YidC and substrate
Fluorescence Stopped-flowRapid kineticsEnvironmentally sensitive probes
ElectrophysiologyIon conductanceReconstituted planar lipid bilayers
Hydrogen-deuterium exchangeConformational dynamicsMass spectrometry detection
Single-molecule fluorescenceIndividual insertion eventsTIRF microscopy with fluorescently labeled components

Electrophysiological approaches have proven particularly valuable, demonstrating that reconstituted YidC forms an ion-conducting pore in the presence of ribosomes or ribosome-nascent chain complexes (RNCs) . This technique provides direct evidence of channel formation and can be used to study the effects of substrate binding on pore properties.

How can researchers effectively reconstitute YidC into proteoliposomes for functional studies?

Proteoliposome reconstitution is critical for functional studies of YidC. A detailed protocol involves:

  • Prepare lipid mixture (typically E. coli polar lipids or defined mixtures containing phosphatidylethanolamine, phosphatidylglycerol, and cardiolipin)

  • Solubilize lipids in chloroform, dry under nitrogen, and rehydrate in buffer

  • Form unilamellar vesicles through extrusion or sonication

  • Add purified YidC at protein:lipid ratios of 1:100 to 1:1000

  • Remove detergent using Bio-Beads or dialysis

  • Verify reconstitution through density gradient centrifugation

For Acidiphilium cryptum YidC, consider incorporating lipids that reflect the acidic environment, potentially including higher proportions of cardiolipin to enhance stability at low pH. Functional verification can be performed using substrate proteins like Pf3 coat protein or ATP synthase subunit c, monitoring their insertion efficiency through protease protection assays or fluorescence-based techniques.

What are the critical considerations for designing site-directed mutagenesis experiments to study YidC function?

Site-directed mutagenesis provides valuable insights into YidC structure-function relationships. When designing such experiments:

  • Target conserved residues in the hydrophilic groove, particularly charged amino acids that may interact with substrate proteins

  • Consider the arginine residue that faces the hydrophobic lipid core, as it appears critical for the insertion mechanism

  • Examine residues at the dimer interface to assess the importance of oligomerization

  • Evaluate transmembrane domain residues that may contribute to pore formation

Mutations should be characterized through complementation assays in YidC-depleted strains, analyzing effects on substrate insertion efficiency, and examining changes in oligomeric state. For Acidiphilium cryptum YidC, additional attention should be paid to residues that may contribute to acid stability, potentially identifying unique adaptations not present in neutrophilic homologs.

How can researchers optimize in vitro translation systems to study co-translational insertion mediated by YidC?

In vitro translation systems are powerful tools for studying co-translational insertion. Optimization strategies include:

  • Select an appropriate cell-free system (E. coli extract, PURE system, or wheat germ extract)

  • Include purified ribosomes, YidC-containing proteoliposomes, and necessary translation factors

  • Design mRNA constructs with optimal translation initiation sites and appropriate coding sequences for YidC substrates

  • Label nascent chains with fluorescent or radioactive amino acids for detection

  • Monitor insertion through protease protection assays, gel shift analyses, or fluorescence techniques

For studying ribosome-YidC interactions specifically, researchers can prepare ribosome-nascent chain complexes (RNCs) by using truncated mRNAs lacking stop codons. These RNCs can then be incubated with YidC-containing proteoliposomes to study the insertion process in detail, potentially using electrophysiological measurements to detect pore formation .

How can understanding YidC function in Acidiphilium cryptum contribute to biotechnological applications?

The unique properties of Acidiphilium cryptum YidC, adapted to function in acidic environments, offer several biotechnological opportunities:

  • Development of expression systems for acid-stable membrane proteins

  • Creation of acid-resistant cell factories for bioproduction processes

  • Engineering membrane protein insertases with enhanced stability for industrial applications

  • Designing biomimetic membranes with improved performance in extreme conditions

Research into these applications requires comparative structural and functional analyses between Acidiphilium cryptum YidC and homologs from neutrophilic organisms, identifying specific adaptations that confer acid stability and potentially transferring these features to other systems through protein engineering.

What emerging technologies might advance our understanding of YidC-mediated insertion mechanisms?

Several cutting-edge technologies show promise for advancing YidC research:

TechnologyApplicationPotential Insights
Cryo-EMHigh-resolution structuresVisualization of YidC-substrate complexes
NanodiscsNative-like membrane environmentFunctional studies without detergents
AlphaFold and other AI toolsStructure predictionModels of poorly characterized complexes
Time-resolved XFELDynamic structural changesCapturing insertion intermediates
Cellular cryo-tomographyIn situ visualizationNative membrane organization

The application of AlphaFold has already provided valuable structural models, including a parallel YidC dimer that harbors a pore consistent with experimental observations . Integration of these technologies will likely reveal new insights into the dynamic process of membrane protein insertion.

How does the lipid scramblase activity of YidC influence membrane organization in Acidiphilium cryptum?

Recent research suggests that YidC functions not only as an insertase but also as a lipid scramblase, contributing to membrane lipid organization. This activity appears to be regulated by YibN, as overproduction of YibN stimulates membrane lipid production and promotes inner membrane proliferation, potentially by interfering with YidC lipid scramblase activity .

For Acidiphilium cryptum, which thrives in acidic environments, this lipid organization function may be particularly important for maintaining membrane integrity under stress conditions. Future research should investigate:

  • The lipid composition of Acidiphilium cryptum membranes and how it differs from neutrophilic bacteria

  • The specific effects of YidC on lipid distribution in acidic conditions

  • The relationship between YidC's insertase and scramblase activities

  • The potential role of YibN homologs in regulating YidC function in Acidiphilium cryptum

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.