Recombinant Acidiphilium cryptum Protease HtpX homolog (htpX)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery time estimates, please consult your local distributor.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing it.
Synonyms
htpX; Acry_0199; Protease HtpX homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-287
Protein Length
full length protein
Species
Acidiphilium cryptum (strain JF-5)
Target Names
htpX
Target Protein Sequence
MPNLIRTGLLMAALTALFVAIGYWIGRGAGAAIALAFAAAGNFVAYWVSDRAVLAMYGAQ PANQAAFPRLVAQVDRLASKAGLPPPRVYVIDNDQPNAFATGRNPQHAAIAVTTGLLGAL DEAELAGVIAHELSHIRHRDTLTMTVTATLAGAIGMISNLAIFFGGSDERRSSPFAGIAG LLLLLLAPLTATLVQLAISRTREYAADARAASLTGQPLALARALMRIDEMARWVPNDDAE RNPATASLFIVNPLSGTTFDTLFATHPPIRERVARLRHMAQFDVSKN
Uniprot No.

Target Background

Database Links
Protein Families
Peptidase M48B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Acidiphilium cryptum and what are its main characteristics?

Acidiphilium cryptum is a species of heterotrophic bacteria and the type species of its genus. It is gram-negative, aerobic, mesophilic, and rod-shaped. This bacterium does not form endospores, and some cells exhibit motility through one polar flagellum or two lateral flagella. The type strain is Lhet2 (=ATCC 33463) .

Acidiphilium cryptum is an acidophilic α-proteobacterium that thrives in acidic, metal-rich environments. Despite being classified as an acidophile, it demonstrates a relatively modest salt tolerance of up to 5% NaCl . The organism is notable for its ability to utilize organic matter and has been isolated from both natural and man-made acidic environments .

What are the proper storage conditions for recombinant HtpX protein?

Recombinant HtpX protein should be stored according to the following guidelines to maintain stability and activity:

Storage ParameterRecommended Condition
Short-term storage4°C (up to one week)
Standard storage-20°C
Long-term storage-20°C to -80°C
Buffer compositionTris-based buffer with 50% glycerol
Special considerationsAvoid repeated freezing and thawing

For optimal results, it is recommended to prepare small working aliquots to minimize freeze-thaw cycles that can compromise protein integrity .

How does the HtpX protease contribute to the proteostasis network in acidophilic bacteria?

In acidophilic bacteria like Acidiphilium cryptum, the proteostasis network plays a crucial role in maintaining protein homeostasis under extreme environmental conditions. Research indicates that acidophiles possess an abundant and flexible proteostasis network that protects proteins in organisms living in energy-limiting and extreme environmental conditions .

The HtpX protease homolog likely functions as part of this proteostasis network, particularly in the quality control of membrane proteins. Comparative genomics studies of acidophiles have revealed:

  • Systematically high redundancy of genes encoding periplasmic chaperones like HtrA and YidC

  • Broad distribution of proteolytic ATPase complexes like ClpPX and Lon

  • Clustering of genes for chaperones and protease systems within genomes, suggesting common regulation

As a membrane protease, HtpX would contribute to this network by degrading misfolded or damaged membrane proteins, preventing their toxic accumulation under stress conditions.

What is the relationship between HtpX and the production of compatible solutes in Acidiphilium cryptum?

Acidiphilium cryptum has been shown to produce hydroxyectoine in response to elevated NaCl or Al₂(SO₄)₃ levels . The hydroxyectoine biosynthesis proteins from A. cryptum differ from halophilic variants by their less acidic nature, suggesting optimum activity in the absence of salt .

The potential relationship between proteases like HtpX and compatible solute production may involve:

  • Coordinated regulation under stress conditions

  • Protein quality control during osmotic stress

  • Degradation of damaged proteins during adaptation to environmental changes

Further research specifically examining the regulatory connections between these stress response pathways would be needed to establish direct links.

How does the genetic organization of the htpX gene compare to other stress-response genes in Acidiphilium cryptum?

The htpX gene in Acidiphilium cryptum is identified with the ordered locus name Acry_0199 . While specific information about its genomic context is limited in the search results, comparative genomics of proteostasis networks in acidophiles reveals important patterns:

  • Genes for chaperones and protease systems are often clustered within the genomes of acidophiles, suggesting common regulation of these activities

  • Some genes are differentially distributed between bacteria as a function of their autotrophic or heterotrophic metabolism

  • Acidophilic bacteria show redundancy of genes coding for ATP-independent holdase chaperones and periplasmic chaperones

For comparison, the hydroxyectoine biosynthesis gene cluster of A. cryptum contains an additional aspartokinase (ask) gene that overlaps with the ectD gene, potentially addressing a critical bottleneck in the biosynthesis pathway .

What expression systems are most effective for producing recombinant Acidiphilium cryptum proteins?

Based on successful heterologous expression of A. cryptum proteins, the following methodological approach has proven effective:

For E. coli-based expression:

  • Plasmids based on the pASK-IBA3 vector (IBA Lifesciences) provide a robust platform

  • The vector's tet promoter enables high expression levels after induction with anhydrotetracycline (AHT)

  • Integration into chemically competent E. coli DH5α cells via transformation has been successful

When expressing A. cryptum proteins, researchers should consider:

  • The acidophilic origin of the proteins may affect folding and activity in non-acidophilic hosts

  • For membrane proteins like HtpX, specialized E. coli strains optimized for membrane protein expression may be beneficial

  • Expression conditions may need optimization regarding temperature, induction timing, and media composition

This approach has been validated for the expression of the hydroxyectoine biosynthesis gene cluster from A. cryptum in E. coli .

What purification strategies are recommended for obtaining active recombinant HtpX protease?

For successful purification of recombinant HtpX protease while maintaining its activity, researchers should consider the following strategy:

Purification StageRecommended Approach
Affinity tagThe tag type will be determined during the production process to optimize purification efficiency
Cell lysisGentle methods to preserve membrane protein integrity
Membrane fraction isolationUltracentrifugation to separate membrane-associated proteins
SolubilizationAppropriate detergents to solubilize membrane proteins while maintaining structure
ChromatographyAffinity chromatography followed by size exclusion and/or ion exchange chromatography
Buffer compositionTris-based buffer with 50% glycerol has been shown to be effective for storage
Quality controlSDS-PAGE, Western blotting, and activity assays

Since HtpX is likely membrane-associated based on its sequence characteristics, special attention should be paid to the choice of detergents and buffer conditions throughout the purification process.

How can researchers develop activity assays for the HtpX protease?

Developing robust activity assays for the HtpX protease requires consideration of its classification as a metalloprotease (EC 3.4.24.-) . Based on this classification and its likely membrane association, researchers could develop the following assay approaches:

  • Substrate selection:

    • Design peptides containing sequences likely to be recognized by HtpX

    • Consider membrane protein substrates that mimic natural targets

    • Test both soluble and membrane-incorporated substrates

  • Detection methods:

    • Fluorogenic peptide substrates with enhanced fluorescence upon cleavage

    • FRET-based assays with donor-acceptor pairs separated by the cleavage site

    • SDS-PAGE-based degradation assays for protein substrates

    • Mass spectrometry to identify cleavage products and specificity

  • Assay conditions optimization:

    • pH range testing (consider acidic pH given the acidophilic origin)

    • Metal ion dependency assessment (zinc or other divalent cations)

    • Detergent and lipid composition for membrane protein substrates

    • Temperature optimization

  • Controls and validation:

    • Site-directed mutagenesis of catalytic residues as negative controls

    • Protease inhibitor profiling to confirm metalloprotease classification

    • Comparison with related proteases from model organisms

These methodological approaches would enable researchers to establish reliable activity assays for characterizing the enzymatic properties of the HtpX protease.

What techniques can be used to study the in vivo function of HtpX in Acidiphilium cryptum?

To elucidate the in vivo function of HtpX in Acidiphilium cryptum, researchers could employ a combination of genetic, molecular, and physiological approaches:

  • Genetic manipulation:

    • Gene deletion or disruption of htpX

    • Complementation with wild-type and mutant variants

    • Conditional expression systems to control HtpX levels

  • Phenotypic characterization:

    • Growth under various stress conditions (acid, metal, oxidative stress)

    • Membrane protein profiling in wild-type vs. htpX mutants

    • Cellular morphology and ultrastructure analysis

    • Stress response assays comparing wild-type and mutant strains

  • Molecular approaches:

    • Transcriptomic analysis to identify genes affected by htpX mutation

    • Proteomic analysis to identify potential substrates and interacting partners

    • Metabolomic analysis to detect changes in cellular metabolism

    • Protein localization studies using fluorescent protein fusions

  • Physiological studies:

    • Membrane integrity assessment under stress conditions

    • Protein aggregation and misfolding measurements

    • Connection to hydroxyectoine production under salt stress

    • Metal resistance profiling

These approaches would provide comprehensive insights into the role of HtpX within the broader stress response and protein quality control networks of Acidiphilium cryptum.

How can understanding HtpX function contribute to biotechnological applications involving Acidiphilium cryptum?

Understanding HtpX function in Acidiphilium cryptum could enhance various biotechnological applications:

  • Biopolymer production optimization:

    • Acidiphilium cryptum is capable of producing poly-3-hydroxybutyrate (P3HB), with yields of up to 0.88 g of P3HB per gram of dry cells reported

    • Improving protein quality control through HtpX may enhance cell viability during biopolymer accumulation

    • Understanding the relationship between stress response and P3HB synthesis could lead to increased yields

  • Heterologous production systems:

    • Non-halophilic biosynthesis enzymes from Acidiphilium cryptum have been used for efficient heterologous production of ectoines in E. coli

    • Knowledge of proteostasis networks could improve expression of other valuable proteins

    • Protein engineering based on stress-response mechanisms could enhance enzyme stability

  • Extremozyme development:

    • HtpX represents a potential extremozyme adapted to function under acidic conditions

    • Understanding its structure-function relationship could guide the development of acid-stable proteases for industrial applications

    • Protein engineering approaches could adapt HtpX for specific biotechnological purposes

What role might HtpX play in Acidiphilium cryptum's adaptation to metal-rich environments?

Acidiphilium cryptum thrives in acidic, metal-rich environments , suggesting specialized adaptation mechanisms:

  • Metal homeostasis:

    • As a metalloprotease, HtpX may play a role in metal ion homeostasis

    • Degradation of damaged membrane proteins caused by metal toxicity

    • Potential involvement in metal transporter regulation

  • Stress response coordination:

    • Integration of metal stress response with general proteostasis networks

    • Protection of essential membrane proteins from metal-induced damage

    • Coordination with compatible solute production (hydroxyectoine) under combined metal and osmotic stress

  • Membrane integrity maintenance:

    • Removal of metal-damaged membrane proteins to maintain membrane function

    • Prevention of protein aggregation that could compromise cellular integrity

    • Quality control of metal transport and detoxification systems

How does the HtpX protease in Acidiphilium cryptum compare to homologs in other extremophiles?

Comparative analysis of HtpX across extremophiles represents an emerging research direction:

  • Evolutionary adaptations:

    • Sequence variations that reflect adaptation to different extreme environments

    • Conservation patterns of catalytic residues versus variable regions

    • Phylogenetic analysis to trace the evolution of HtpX in relation to habitat specialization

  • Functional specialization:

    • Substrate specificity differences between acidophilic, thermophilic, and halophilic HtpX homologs

    • Activity profiles under different extreme conditions

    • Regulatory mechanisms across diverse extremophiles

  • Structural adaptations:

    • Comparative protein modeling to identify structural features associated with acid stability

    • Analysis of surface charge distribution and hydrophobicity patterns

    • Membrane interaction domains and their adaptation to different environments

This comparative approach could reveal fundamental principles of protein adaptation to extreme environments and inform the design of enzymes for biotechnological applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.